BLASTX nr result
ID: Ophiopogon23_contig00002697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00002697 (536 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020274091.1| mRNA-capping enzyme-like [Asparagus officina... 58 1e-06 gb|ONK63597.1| uncharacterized protein A4U43_C07F16900 [Asparagu... 58 1e-06 ref|XP_020255884.1| mRNA-capping enzyme isoform X3 [Asparagus of... 57 4e-06 ref|XP_020255876.1| mRNA-capping enzyme isoform X1 [Asparagus of... 57 4e-06 >ref|XP_020274091.1| mRNA-capping enzyme-like [Asparagus officinalis] Length = 486 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +1 Query: 1 DNITEEVLLKEIKEIVRLPMYAERISEAEAQEKQKHRSR 117 DNITEEVLL EI EIVRLPMYA+RI+ AEAQ +HR R Sbjct: 448 DNITEEVLLAEIAEIVRLPMYADRIAVAEAQRLHQHRRR 486 >gb|ONK63597.1| uncharacterized protein A4U43_C07F16900 [Asparagus officinalis] Length = 511 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +1 Query: 1 DNITEEVLLKEIKEIVRLPMYAERISEAEAQEKQKHRSR 117 DNITEEVLL EI EIVRLPMYA+RI+ AEAQ +HR R Sbjct: 473 DNITEEVLLAEIAEIVRLPMYADRIAVAEAQRLHQHRRR 511 >ref|XP_020255884.1| mRNA-capping enzyme isoform X3 [Asparagus officinalis] Length = 573 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 1 DNITEEVLLKEIKEIVRLPMYAERISEAEAQEKQKHRSR 117 DNITEEVLL EI E VRLPMYA+RI+ AEAQ +HR R Sbjct: 535 DNITEEVLLSEIAETVRLPMYADRIAVAEAQRLHQHRRR 573 >ref|XP_020255876.1| mRNA-capping enzyme isoform X1 [Asparagus officinalis] ref|XP_020255877.1| mRNA-capping enzyme isoform X1 [Asparagus officinalis] ref|XP_020255878.1| mRNA-capping enzyme isoform X1 [Asparagus officinalis] ref|XP_020255879.1| mRNA-capping enzyme isoform X2 [Asparagus officinalis] ref|XP_020255880.1| mRNA-capping enzyme isoform X1 [Asparagus officinalis] ref|XP_020255881.1| mRNA-capping enzyme isoform X1 [Asparagus officinalis] ref|XP_020255882.1| mRNA-capping enzyme isoform X1 [Asparagus officinalis] ref|XP_020255883.1| mRNA-capping enzyme isoform X1 [Asparagus officinalis] gb|ONK74198.1| uncharacterized protein A4U43_C03F3810 [Asparagus officinalis] Length = 668 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 1 DNITEEVLLKEIKEIVRLPMYAERISEAEAQEKQKHRSR 117 DNITEEVLL EI E VRLPMYA+RI+ AEAQ +HR R Sbjct: 630 DNITEEVLLSEIAETVRLPMYADRIAVAEAQRLHQHRRR 668