BLASTX nr result
ID: Ophiopogon23_contig00001202
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00001202 (2362 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020271483.1| thioredoxin-like protein AAED1, chloroplasti... 67 6e-17 gb|ONK62398.1| uncharacterized protein A4U43_C07F3460 [Asparagus... 67 7e-17 gb|PIN03714.1| hypothetical protein CDL12_23753 [Handroanthus im... 64 7e-16 ref|XP_020108352.1| thioredoxin-like protein AAED1, chloroplasti... 59 1e-15 dbj|GAV84192.1| AhpC-TSA_2 domain-containing protein [Cephalotus... 59 4e-15 ref|XP_021861488.1| thioredoxin-like protein AAED1, chloroplasti... 60 6e-15 ref|XP_008789027.1| PREDICTED: thioredoxin-like protein AAED1, c... 65 6e-15 gb|KNA04641.1| hypothetical protein SOVF_197750 [Spinacia oleracea] 60 6e-15 ref|XP_021666863.1| thioredoxin-like protein AAED1, chloroplasti... 62 7e-15 ref|XP_021666864.1| thioredoxin-like protein AAED1, chloroplasti... 62 7e-15 ref|XP_020591228.1| thioredoxin-like protein AAED1, chloroplasti... 62 9e-15 ref|XP_020686381.1| thioredoxin-like protein AAED1, chloroplasti... 61 2e-14 ref|XP_020686382.1| thioredoxin-like protein AAED1, chloroplasti... 61 2e-14 gb|EPS73122.1| hypothetical protein M569_01635, partial [Genlise... 62 2e-14 ref|XP_023905058.1| thioredoxin-like protein AAED1, chloroplasti... 64 2e-14 ref|XP_023905059.1| thioredoxin-like protein AAED1, chloroplasti... 64 2e-14 ref|XP_010937779.1| PREDICTED: thioredoxin-like protein AAED1, c... 63 2e-14 ref|XP_023889842.1| thioredoxin-like protein AAED1, chloroplasti... 64 2e-14 ref|XP_012082257.1| thioredoxin-like protein AAED1, chloroplasti... 61 2e-14 ref|XP_002525198.1| PREDICTED: thioredoxin-like protein AAED1, c... 62 3e-14 >ref|XP_020271483.1| thioredoxin-like protein AAED1, chloroplastic [Asparagus officinalis] Length = 269 Score = 67.4 bits (163), Expect(2) = 6e-17 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACCL 731 GPGTSNIS+IH+DKEAGDDPDMEDV+KACCL Sbjct: 239 GPGTSNISYIHRDKEAGDDPDMEDVIKACCL 269 Score = 51.2 bits (121), Expect(2) = 6e-17 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 EIYADP+HSSY+A FVYGVSTTFTP Sbjct: 173 EIYADPDHSSYNALNFVYGVSTTFTP 198 >gb|ONK62398.1| uncharacterized protein A4U43_C07F3460 [Asparagus officinalis] Length = 195 Score = 67.4 bits (163), Expect(2) = 7e-17 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACCL 731 GPGTSNIS+IH+DKEAGDDPDMEDV+KACCL Sbjct: 165 GPGTSNISYIHRDKEAGDDPDMEDVIKACCL 195 Score = 51.2 bits (121), Expect(2) = 7e-17 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 EIYADP+HSSY+A FVYGVSTTFTP Sbjct: 99 EIYADPDHSSYNALNFVYGVSTTFTP 124 >gb|PIN03714.1| hypothetical protein CDL12_23753 [Handroanthus impetiginosus] Length = 283 Score = 63.9 bits (154), Expect(2) = 7e-16 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACCL 731 GPG +NIS+IHKDKEAGDDPD+ED+LKACCL Sbjct: 250 GPGKNNISYIHKDKEAGDDPDIEDILKACCL 280 Score = 51.2 bits (121), Expect(2) = 7e-16 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 E+YADP+HSSYDA KFV GVSTTFTP Sbjct: 184 EVYADPSHSSYDALKFVSGVSTTFTP 209 >ref|XP_020108352.1| thioredoxin-like protein AAED1, chloroplastic [Ananas comosus] ref|XP_020108353.1| thioredoxin-like protein AAED1, chloroplastic [Ananas comosus] Length = 255 Score = 58.9 bits (141), Expect(2) = 1e-15 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACC 728 GPG +NI +IHKDKEAGDDP++EDVLKACC Sbjct: 225 GPGVNNILYIHKDKEAGDDPNIEDVLKACC 254 Score = 55.5 bits (132), Expect(2) = 1e-15 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 EIYADPNHSSYDA KF YGVSTTFTP Sbjct: 159 EIYADPNHSSYDALKFAYGVSTTFTP 184 >dbj|GAV84192.1| AhpC-TSA_2 domain-containing protein [Cephalotus follicularis] Length = 252 Score = 58.9 bits (141), Expect(2) = 4e-15 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACC 728 GPG SNIS+IH+DKEAGDDP ME++LKACC Sbjct: 222 GPGKSNISYIHRDKEAGDDPVMEEILKACC 251 Score = 53.5 bits (127), Expect(2) = 4e-15 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 E+YADP+HSSYDA +FVYGVSTTFTP Sbjct: 156 EVYADPSHSSYDALRFVYGVSTTFTP 181 >ref|XP_021861488.1| thioredoxin-like protein AAED1, chloroplastic isoform X3 [Spinacia oleracea] Length = 258 Score = 59.7 bits (143), Expect(2) = 6e-15 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACC 728 GPG +NIS+IHKDKEAGDDP +ED+LKACC Sbjct: 228 GPGKTNISYIHKDKEAGDDPPIEDILKACC 257 Score = 52.4 bits (124), Expect(2) = 6e-15 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = +1 Query: 517 DAEIYADPNHSSYDAFKFVYGVSTTFTP 600 + E+Y DPNHSSYDA KFV GVSTTFTP Sbjct: 160 EGEVYVDPNHSSYDALKFVSGVSTTFTP 187 >ref|XP_008789027.1| PREDICTED: thioredoxin-like protein AAED1, chloroplastic [Phoenix dactylifera] Length = 256 Score = 64.7 bits (156), Expect(2) = 6e-15 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACCL 731 GPG SNIS+IHKDKEAGDDPD+EDV+KACCL Sbjct: 226 GPGVSNISYIHKDKEAGDDPDIEDVVKACCL 256 Score = 47.4 bits (111), Expect(2) = 6e-15 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 E+YADP+HSS++A F YGVSTTFTP Sbjct: 160 EVYADPSHSSFNALDFAYGVSTTFTP 185 >gb|KNA04641.1| hypothetical protein SOVF_197750 [Spinacia oleracea] Length = 127 Score = 59.7 bits (143), Expect(2) = 6e-15 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACC 728 GPG +NIS+IHKDKEAGDDP +ED+LKACC Sbjct: 97 GPGKTNISYIHKDKEAGDDPPIEDILKACC 126 Score = 52.4 bits (124), Expect(2) = 6e-15 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = +1 Query: 517 DAEIYADPNHSSYDAFKFVYGVSTTFTP 600 + E+Y DPNHSSYDA KFV GVSTTFTP Sbjct: 29 EGEVYVDPNHSSYDALKFVSGVSTTFTP 56 >ref|XP_021666863.1| thioredoxin-like protein AAED1, chloroplastic isoform X1 [Hevea brasiliensis] Length = 268 Score = 62.4 bits (150), Expect(2) = 7e-15 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACC 728 GPG +NIS+IHKDKEAGDDPD+ED+LKACC Sbjct: 238 GPGKTNISYIHKDKEAGDDPDIEDILKACC 267 Score = 49.3 bits (116), Expect(2) = 7e-15 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 E+YADPNHSSY+A KFV GV TTFTP Sbjct: 172 EVYADPNHSSYEALKFVSGVLTTFTP 197 >ref|XP_021666864.1| thioredoxin-like protein AAED1, chloroplastic isoform X2 [Hevea brasiliensis] Length = 253 Score = 62.4 bits (150), Expect(2) = 7e-15 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACC 728 GPG +NIS+IHKDKEAGDDPD+ED+LKACC Sbjct: 223 GPGKTNISYIHKDKEAGDDPDIEDILKACC 252 Score = 49.3 bits (116), Expect(2) = 7e-15 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 E+YADPNHSSY+A KFV GV TTFTP Sbjct: 157 EVYADPNHSSYEALKFVSGVLTTFTP 182 >ref|XP_020591228.1| thioredoxin-like protein AAED1, chloroplastic [Phalaenopsis equestris] Length = 254 Score = 62.0 bits (149), Expect(2) = 9e-15 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACC 728 GPGTSNIS++HKDKEAGDDP++EDVL+ACC Sbjct: 224 GPGTSNISYLHKDKEAGDDPNIEDVLQACC 253 Score = 49.3 bits (116), Expect(2) = 9e-15 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 E+YADP HSS+DA F YGVSTTFTP Sbjct: 158 EVYADPTHSSFDALNFAYGVSTTFTP 183 >ref|XP_020686381.1| thioredoxin-like protein AAED1, chloroplastic isoform X1 [Dendrobium catenatum] gb|PKU63004.1| Thioredoxin-like protein AAED1, chloroplastic [Dendrobium catenatum] Length = 254 Score = 61.2 bits (147), Expect(2) = 2e-14 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACC 728 GPGTSNIS+ HKDKEAGDDP++EDVL+ACC Sbjct: 224 GPGTSNISYFHKDKEAGDDPNVEDVLQACC 253 Score = 49.3 bits (116), Expect(2) = 2e-14 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 E+YADP HSS+DA F YGVSTTFTP Sbjct: 158 EVYADPTHSSFDALNFAYGVSTTFTP 183 >ref|XP_020686382.1| thioredoxin-like protein AAED1, chloroplastic isoform X2 [Dendrobium catenatum] Length = 234 Score = 61.2 bits (147), Expect(2) = 2e-14 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACC 728 GPGTSNIS+ HKDKEAGDDP++EDVL+ACC Sbjct: 204 GPGTSNISYFHKDKEAGDDPNVEDVLQACC 233 Score = 49.3 bits (116), Expect(2) = 2e-14 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 E+YADP HSS+DA F YGVSTTFTP Sbjct: 138 EVYADPTHSSFDALNFAYGVSTTFTP 163 >gb|EPS73122.1| hypothetical protein M569_01635, partial [Genlisea aurea] Length = 185 Score = 61.6 bits (148), Expect(2) = 2e-14 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACCL 731 GPG +NIS++HKDKEAGDDPD++D+LKACC+ Sbjct: 155 GPGKTNISYVHKDKEAGDDPDIDDILKACCM 185 Score = 48.9 bits (115), Expect(2) = 2e-14 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 E+YADP++SSY AFKFV GVSTTFTP Sbjct: 89 EVYADPSYSSYQAFKFVSGVSTTFTP 114 >ref|XP_023905058.1| thioredoxin-like protein AAED1, chloroplastic isoform X1 [Quercus suber] Length = 258 Score = 63.5 bits (153), Expect(2) = 2e-14 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACC 728 GPG SNIS+IHKDKEAGDDPD+ED+LKACC Sbjct: 228 GPGKSNISYIHKDKEAGDDPDIEDILKACC 257 Score = 46.6 bits (109), Expect(2) = 2e-14 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 E+YADPNHSSY A +FV GV TTFTP Sbjct: 162 EVYADPNHSSYKALEFVSGVLTTFTP 187 >ref|XP_023905059.1| thioredoxin-like protein AAED1, chloroplastic isoform X2 [Quercus suber] Length = 256 Score = 63.5 bits (153), Expect(2) = 2e-14 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACC 728 GPG SNIS+IHKDKEAGDDPD+ED+LKACC Sbjct: 226 GPGKSNISYIHKDKEAGDDPDIEDILKACC 255 Score = 46.6 bits (109), Expect(2) = 2e-14 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 E+YADPNHSSY A +FV GV TTFTP Sbjct: 160 EVYADPNHSSYKALEFVSGVLTTFTP 185 >ref|XP_010937779.1| PREDICTED: thioredoxin-like protein AAED1, chloroplastic [Elaeis guineensis] Length = 256 Score = 62.8 bits (151), Expect(2) = 2e-14 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACCL 731 GPG SNIS+IHKDKEAGDDP++EDV+KACCL Sbjct: 226 GPGVSNISYIHKDKEAGDDPNIEDVVKACCL 256 Score = 47.4 bits (111), Expect(2) = 2e-14 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 E+YADP+HSS++A F YGVSTTFTP Sbjct: 160 EVYADPSHSSFNALDFAYGVSTTFTP 185 >ref|XP_023889842.1| thioredoxin-like protein AAED1, chloroplastic [Quercus suber] Length = 252 Score = 63.5 bits (153), Expect(2) = 2e-14 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACC 728 GPG SNIS+IHKDKEAGDDPD+ED+LKACC Sbjct: 222 GPGKSNISYIHKDKEAGDDPDIEDILKACC 251 Score = 46.6 bits (109), Expect(2) = 2e-14 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 E+YADPNHSSY A +FV GV TTFTP Sbjct: 156 EVYADPNHSSYKALEFVSGVLTTFTP 181 >ref|XP_012082257.1| thioredoxin-like protein AAED1, chloroplastic [Jatropha curcas] Length = 249 Score = 60.8 bits (146), Expect(2) = 2e-14 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACC 728 GPG +NIS+IHKDKEAGDDPD+E++LKACC Sbjct: 219 GPGKTNISYIHKDKEAGDDPDIEEILKACC 248 Score = 49.3 bits (116), Expect(2) = 2e-14 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 E+YADP HSSY+A KFV GVSTTFTP Sbjct: 153 EVYADPTHSSYEALKFVSGVSTTFTP 178 >ref|XP_002525198.1| PREDICTED: thioredoxin-like protein AAED1, chloroplastic isoform X1 [Ricinus communis] gb|EEF37164.1| conserved hypothetical protein [Ricinus communis] Length = 249 Score = 62.4 bits (150), Expect(2) = 3e-14 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 639 GPGTSNISFIHKDKEAGDDPDMEDVLKACC 728 GPG +NIS+IHKDKEAGDDPD+ED+LKACC Sbjct: 219 GPGKTNISYIHKDKEAGDDPDIEDILKACC 248 Score = 47.4 bits (111), Expect(2) = 3e-14 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = +1 Query: 523 EIYADPNHSSYDAFKFVYGVSTTFTP 600 E+YAD +HSSY+AF+FV GVSTTFTP Sbjct: 153 EVYADTSHSSYEAFQFVSGVSTTFTP 178