BLASTX nr result
ID: Ophiopogon23_contig00001109
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00001109 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK71446.1| uncharacterized protein A4U43_C04F8650 [Asparagus... 96 2e-20 gb|ONK71454.1| uncharacterized protein A4U43_C04F8830 [Asparagus... 78 2e-14 ref|XP_020260535.1| branchpoint-bridging protein-like [Asparagus... 77 1e-13 ref|XP_008806841.1| PREDICTED: branchpoint-bridging protein-like... 56 3e-06 >gb|ONK71446.1| uncharacterized protein A4U43_C04F8650 [Asparagus officinalis] Length = 810 Score = 96.3 bits (238), Expect = 2e-20 Identities = 67/138 (48%), Positives = 83/138 (60%), Gaps = 8/138 (5%) Frame = -1 Query: 392 EEEPCQGSPVNSLYNRSNENSTQSNLGNMNIPSGTK----RISELSGIRNSSNNVIVQEK 225 +EEP GS VN Y+++N NS Q +LG MN+ S R SELS I+NSS N IV EK Sbjct: 149 DEEPTCGSSVNQSYDKNN-NSAQFSLGKMNMSSNITSCAGRPSELSCIKNSSGNAIVPEK 207 Query: 224 QATTGSTGKKRHSKWDI-KDEANKLAEVGD-GIAR--KKSKTRWSRWSDDNSQFSMGTTL 57 TGKKR +WDI ++E + AE G G +R +K KTR SRWS ++SQ S T Sbjct: 208 LPANEITGKKRRRRWDISENEVKEQAETGKFGQSRESEKRKTRRSRWSSEDSQHSWALTP 267 Query: 56 KSPGIEINLEIPKLHAQL 3 PG +LE PKL AQL Sbjct: 268 NHPGGN-DLETPKLLAQL 284 >gb|ONK71454.1| uncharacterized protein A4U43_C04F8830 [Asparagus officinalis] Length = 294 Score = 77.8 bits (190), Expect = 2e-14 Identities = 46/112 (41%), Positives = 63/112 (56%), Gaps = 8/112 (7%) Frame = -1 Query: 410 EPSVDPEEEPCQGSPVNSLYNRSNENSTQSNLGNMNIPS---GTKRISELSGIRNSSNNV 240 +P P+E+PC GSPVN YNR N+ S Q N G MN+ S R SELS + NS+ NV Sbjct: 185 DPEEPPDEKPCGGSPVNQFYNRKNKISAQFNSGKMNMTSDIASAPRFSELSCVMNSAGNV 244 Query: 239 IVQEKQATTGSTGKKRHSKWDIKDEANKLAEVGDGI-----ARKKSKTRWSR 99 V EK GKKR + ++ + NK+ E+ + + + +K KTR SR Sbjct: 245 TVPEKLPAKEIAGKKRCDRGNVTE--NKVKELAENVGSIVSSSEKRKTRQSR 294 >ref|XP_020260535.1| branchpoint-bridging protein-like [Asparagus officinalis] Length = 635 Score = 76.6 bits (187), Expect = 1e-13 Identities = 53/105 (50%), Positives = 63/105 (60%), Gaps = 4/105 (3%) Frame = -1 Query: 305 NIPSGTKRISELSGIRNSSNNVIVQEKQATTGSTGKKRHSKWDI-KDEANKLAEVGD-GI 132 NI S R SELS I+NSS N IV EK TGKKR +WDI ++E + AE G G Sbjct: 6 NITSCAGRPSELSCIKNSSGNAIVPEKLPANEITGKKRRRRWDISENEVKEQAETGKFGQ 65 Query: 131 AR--KKSKTRWSRWSDDNSQFSMGTTLKSPGIEINLEIPKLHAQL 3 +R +K KTR SRWS ++SQ S T PG +LE PKL AQL Sbjct: 66 SRESEKRKTRRSRWSSEDSQHSWALTPNHPGGN-DLETPKLLAQL 109 >ref|XP_008806841.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera] Length = 746 Score = 55.8 bits (133), Expect = 3e-06 Identities = 43/107 (40%), Positives = 55/107 (51%), Gaps = 8/107 (7%) Frame = -1 Query: 299 PSGTKRISELSGIRNSSNNVIVQEKQATTGSTGKKRHSKWDIKDEANKLAEVGDGIARKK 120 PSGT + S N + VI ++Q +GS+GKKR +WD K EA+ A G +A KK Sbjct: 157 PSGTDPQDKPS---NLIDEVISSKEQENSGSSGKKRPRRWDTKSEADGAAFDGGVMATKK 213 Query: 119 SKTRWSRWSDDNSQFSMGTTLKSPGIE--------INLEIPKLHAQL 3 K RW D+SQ M LK P I+ EI KL+AQL Sbjct: 214 RK---KRWVIDDSQLKMLGPLKLPDFVNWPLTETLIDPEIQKLNAQL 257