BLASTX nr result
ID: Ophiopogon23_contig00000596
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00000596 (390 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AQK54475.1| DNA topoisomerase 2 [Zea mays] 54 7e-06 >gb|AQK54475.1| DNA topoisomerase 2 [Zea mays] Length = 551 Score = 54.3 bits (129), Expect = 7e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -3 Query: 166 IKQSLSLQHGKHYNSLKNLRYGSLMIMTYQVWH 68 IKQ L LQHGK Y+S K LRYG LMIMT QVWH Sbjct: 501 IKQILGLQHGKQYDSTKGLRYGHLMIMTDQVWH 533