BLASTX nr result
ID: Ophiopogon23_contig00000261
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00000261 (552 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017634359.1| PREDICTED: luc7-like protein 3 isoform X1 [G... 69 4e-12 gb|KJB40096.1| hypothetical protein B456_007G046600 [Gossypium r... 70 3e-11 gb|ERN00735.1| hypothetical protein AMTR_s00106p00111910 [Ambore... 70 3e-11 gb|KJB51432.1| hypothetical protein B456_008G215900 [Gossypium r... 70 3e-11 ref|XP_017182154.1| PREDICTED: luc7-like protein 3 [Malus domest... 68 3e-11 ref|XP_017185898.1| PREDICTED: luc7-like protein 3 [Malus domest... 68 4e-11 ref|XP_012489075.1| PREDICTED: luc7-like protein 3 isoform X2 [G... 70 4e-11 ref|XP_022771940.1| luc7-like protein 3 isoform X2 [Durio zibeth... 70 4e-11 ref|XP_017637170.1| PREDICTED: luc7-like protein 3 isoform X2 [G... 70 4e-11 ref|XP_016721198.1| PREDICTED: luc7-like protein 3 isoform X2 [G... 70 4e-11 ref|XP_021286466.1| luc7-like protein 3 isoform X2 [Herrania umb... 70 4e-11 ref|XP_016746336.1| PREDICTED: luc7-like protein 3 isoform X2 [G... 70 4e-11 ref|XP_012439142.1| PREDICTED: luc7-like protein 3 isoform X2 [G... 70 4e-11 gb|EOY22883.1| LUC7 N_terminus domain-containing protein isoform... 70 4e-11 gb|KJB51431.1| hypothetical protein B456_008G215900 [Gossypium r... 70 5e-11 gb|KJB51429.1| hypothetical protein B456_008G215900 [Gossypium r... 70 5e-11 gb|PPD73747.1| hypothetical protein GOBAR_DD29321 [Gossypium bar... 70 5e-11 ref|XP_020247353.1| luc7-like protein 3 [Asparagus officinalis] 70 6e-11 ref|XP_012489074.1| PREDICTED: luc7-like protein 3 isoform X1 [G... 70 6e-11 ref|XP_022771912.1| luc7-like protein 3 isoform X1 [Durio zibeth... 70 6e-11 >ref|XP_017634359.1| PREDICTED: luc7-like protein 3 isoform X1 [Gossypium arboreum] Length = 354 Score = 69.3 bits (168), Expect(2) = 4e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYG+VRDFISEF Sbjct: 201 FLVANDAAERTQSHVTGKQHIGYGLVRDFISEF 233 Score = 29.3 bits (64), Expect(2) = 4e-12 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -2 Query: 452 RLQENERDLLGRRKQKNEES*GRRNMKIG 366 R + ++ R+K KN ES GRRNM++G Sbjct: 237 RKEGKRKNYQERKKPKNGESRGRRNMRVG 265 >gb|KJB40096.1| hypothetical protein B456_007G046600 [Gossypium raimondii] Length = 251 Score = 70.5 bits (171), Expect = 3e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 104 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 136 >gb|ERN00735.1| hypothetical protein AMTR_s00106p00111910 [Amborella trichopoda] Length = 227 Score = 70.1 bits (170), Expect = 3e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSH+TGKQHIGYGMVRDFISEF Sbjct: 191 FLVANDAAERTQSHITGKQHIGYGMVRDFISEF 223 >gb|KJB51432.1| hypothetical protein B456_008G215900 [Gossypium raimondii] Length = 254 Score = 70.5 bits (171), Expect = 3e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 104 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 136 >ref|XP_017182154.1| PREDICTED: luc7-like protein 3 [Malus domestica] Length = 130 Score = 67.8 bits (164), Expect = 3e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDA ERTQSHVTGKQHIGYGMVRDFI+EF Sbjct: 17 FLVANDAVERTQSHVTGKQHIGYGMVRDFIAEF 49 >ref|XP_017185898.1| PREDICTED: luc7-like protein 3 [Malus domestica] Length = 139 Score = 67.8 bits (164), Expect = 4e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDA ERTQSHVTGKQHIGYGMVRDFI+EF Sbjct: 63 FLVANDAVERTQSHVTGKQHIGYGMVRDFIAEF 95 >ref|XP_012489075.1| PREDICTED: luc7-like protein 3 isoform X2 [Gossypium raimondii] ref|XP_012489076.1| PREDICTED: luc7-like protein 3 isoform X2 [Gossypium raimondii] Length = 288 Score = 70.5 bits (171), Expect = 4e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 141 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 173 >ref|XP_022771940.1| luc7-like protein 3 isoform X2 [Durio zibethinus] Length = 289 Score = 70.5 bits (171), Expect = 4e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 141 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 173 >ref|XP_017637170.1| PREDICTED: luc7-like protein 3 isoform X2 [Gossypium arboreum] Length = 290 Score = 70.5 bits (171), Expect = 4e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 141 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 173 >ref|XP_016721198.1| PREDICTED: luc7-like protein 3 isoform X2 [Gossypium hirsutum] Length = 290 Score = 70.5 bits (171), Expect = 4e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 141 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 173 >ref|XP_021286466.1| luc7-like protein 3 isoform X2 [Herrania umbratica] Length = 291 Score = 70.5 bits (171), Expect = 4e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 141 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 173 >ref|XP_016746336.1| PREDICTED: luc7-like protein 3 isoform X2 [Gossypium hirsutum] Length = 291 Score = 70.5 bits (171), Expect = 4e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 141 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 173 >ref|XP_012439142.1| PREDICTED: luc7-like protein 3 isoform X2 [Gossypium raimondii] Length = 291 Score = 70.5 bits (171), Expect = 4e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 141 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 173 >gb|EOY22883.1| LUC7 N_terminus domain-containing protein isoform 3 [Theobroma cacao] Length = 291 Score = 70.5 bits (171), Expect = 4e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 141 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 173 >gb|KJB51431.1| hypothetical protein B456_008G215900 [Gossypium raimondii] Length = 324 Score = 70.5 bits (171), Expect = 5e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 174 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 206 >gb|KJB51429.1| hypothetical protein B456_008G215900 [Gossypium raimondii] Length = 326 Score = 70.5 bits (171), Expect = 5e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 176 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 208 >gb|PPD73747.1| hypothetical protein GOBAR_DD29321 [Gossypium barbadense] Length = 338 Score = 70.5 bits (171), Expect = 5e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 201 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 233 >ref|XP_020247353.1| luc7-like protein 3 [Asparagus officinalis] Length = 346 Score = 70.5 bits (171), Expect = 6e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 199 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 231 >ref|XP_012489074.1| PREDICTED: luc7-like protein 3 isoform X1 [Gossypium raimondii] gb|KJB40094.1| hypothetical protein B456_007G046600 [Gossypium raimondii] gb|KJB40095.1| hypothetical protein B456_007G046600 [Gossypium raimondii] Length = 348 Score = 70.5 bits (171), Expect = 6e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 201 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 233 >ref|XP_022771912.1| luc7-like protein 3 isoform X1 [Durio zibethinus] ref|XP_022771928.1| luc7-like protein 3 isoform X1 [Durio zibethinus] Length = 349 Score = 70.5 bits (171), Expect = 6e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 552 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 454 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF Sbjct: 201 FLVANDAAERTQSHVTGKQHIGYGMVRDFISEF 233