BLASTX nr result
ID: Ophiopogon22_contig00039909
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00039909 (1423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAN11505.1| hypothetical protein MAM1_0640c11068 [Mucor ambi... 55 3e-06 >dbj|GAN11505.1| hypothetical protein MAM1_0640c11068 [Mucor ambiguus] Length = 74 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 1265 FRGRPAISRLDWPFTPCHSSSEPLATDTRSVL 1360 FRG PAISRLDWPFTP H+SS+P+AT T SVL Sbjct: 2 FRGIPAISRLDWPFTPYHNSSKPIATGTGSVL 33