BLASTX nr result
ID: Ophiopogon22_contig00039775
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00039775 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK74579.1| uncharacterized protein A4U43_C03F7940 [Asparagus... 53 6e-06 >gb|ONK74579.1| uncharacterized protein A4U43_C03F7940 [Asparagus officinalis] Length = 159 Score = 53.1 bits (126), Expect = 6e-06 Identities = 32/66 (48%), Positives = 34/66 (51%), Gaps = 18/66 (27%) Frame = -1 Query: 364 APAPIKVEQQQPAVTSEMNET------------------GFLSPSFYSTLCSFPLLSPGS 239 APAPIKVEQ+ E G LSPSFYS CSFPLLSP S Sbjct: 94 APAPIKVEQRLAVPLMEQTSLQGGGDPEMMSQGPNGGMMGLLSPSFYSNWCSFPLLSPAS 153 Query: 238 MAALES 221 MAAL+S Sbjct: 154 MAALDS 159