BLASTX nr result
ID: Ophiopogon22_contig00039660
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00039660 (351 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADI16723.1| hypothetical protein [uncultured Verrucomicrobial... 56 3e-08 gb|EFD61410.1| conserved hypothetical protein [Mycobacterium tub... 54 5e-07 gb|ADI22944.1| hypothetical protein [uncultured actinobacterium ... 55 8e-07 gb|ADI17229.1| hypothetical protein, partial [uncultured alpha p... 54 1e-06 gb|PNH17462.1| hypothetical protein BWZ13_01995 [Lactobacillus i... 52 2e-06 dbj|BAU03701.1| hypothetical protein VIGAN_UM160600, partial [Vi... 52 3e-06 gb|KUK19636.1| hypothetical protein XD55_0291 [Thermodesulfobact... 54 4e-06 >gb|ADI16723.1| hypothetical protein [uncultured Verrucomicrobiales bacterium HF0010_05E02] Length = 51 Score = 55.8 bits (133), Expect = 3e-08 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 96 LCIDYALRPRLSSRLTLGGRTLPRKPWVYGD 4 +CI Y+LRP LSSRLTLGGRT PRKP+ YGD Sbjct: 1 MCIGYSLRPHLSSRLTLGGRTFPRKPYPYGD 31 >gb|EFD61410.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054] Length = 80 Score = 53.5 bits (127), Expect = 5e-07 Identities = 28/52 (53%), Positives = 30/52 (57%) Frame = -1 Query: 156 MCSHASFAALTPAGAGIFNLLCIDYALRPRLSSRLTLGGRTLPRKPWVYGDQ 1 M S A + G G N L IDYA RPRL SRLTLGG PR PW +G Q Sbjct: 1 MVSTADSSRAPTHGYGNINPLSIDYACRPRLRSRLTLGGLAWPRNPWSFGGQ 52 >gb|ADI22944.1| hypothetical protein [uncultured actinobacterium HF0500_35G12] Length = 195 Score = 55.5 bits (132), Expect = 8e-07 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -1 Query: 102 NLLCIDYALRPRLSSRLTLGGRTLPRKPWVYG 7 N LCIDYA RPRLSSRLTLGG +LPR PW G Sbjct: 67 NRLCIDYASRPRLSSRLTLGGLSLPRNPWTSG 98 >gb|ADI17229.1| hypothetical protein, partial [uncultured alpha proteobacterium HF0070_14E07] Length = 139 Score = 53.9 bits (128), Expect = 1e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -1 Query: 102 NLLCIDYALRPRLSSRLTLGGRTLPRKPWVYGD 4 NL+ IDY RPRL RLTLGG TLPR PW YG+ Sbjct: 16 NLIPIDYGFRPRLRGRLTLGGLTLPRNPWAYGE 48 >gb|PNH17462.1| hypothetical protein BWZ13_01995 [Lactobacillus iners] Length = 70 Score = 52.0 bits (123), Expect = 2e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = -2 Query: 101 TCCASTTPYGLVLAPD*PWEDEPCPGNLGFTA 6 TCC S TP GL L PD PW DEP PGNL +A Sbjct: 9 TCCPSATPLGLTLGPDLPWADEPAPGNLSLSA 40 >dbj|BAU03701.1| hypothetical protein VIGAN_UM160600, partial [Vigna angularis var. angularis] Length = 77 Score = 51.6 bits (122), Expect = 3e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -2 Query: 101 TCCASTTPYGLVLAPD*PWEDEPCPGNLGFT 9 TCC STTP+GL+L PD P DEPC G LGF+ Sbjct: 17 TCCPSTTPFGLILGPDSPSVDEPCGGTLGFS 47 >gb|KUK19636.1| hypothetical protein XD55_0291 [Thermodesulfobacterium commune] Length = 191 Score = 53.5 bits (127), Expect = 4e-06 Identities = 26/46 (56%), Positives = 28/46 (60%) Frame = -1 Query: 144 ASFAALTPAGAGIFNLLCIDYALRPRLSSRLTLGGRTLPRKPWVYG 7 AS L G GI L I YA RP++ RLTLGGR PRKPW YG Sbjct: 125 ASPLGLHSGGGGILTPLPIPYAFRPQVRGRLTLGGRPFPRKPWAYG 170