BLASTX nr result
ID: Ophiopogon22_contig00039594
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00039594 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_073495607.1| hypothetical protein [Enterococcus faecalis] 53 2e-06 ref|WP_073990125.1| hypothetical protein [Enterococcus faecium] 53 2e-06 ref|WP_073990085.1| hypothetical protein [Enterococcus faecium] 51 9e-06 ref|WP_073495518.1| hypothetical protein [Enterococcus faecalis] 51 9e-06 >ref|WP_073495607.1| hypothetical protein [Enterococcus faecalis] Length = 93 Score = 53.1 bits (126), Expect = 2e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +1 Query: 307 KFVYG*GFRPVLGVVGLLGPRSEERRVGKECRSRWSPYH 423 +FVY F+P++G V + RSEERRVGKECRSRWSPYH Sbjct: 56 EFVYLLLFKPLVGNVDAVA-RSEERRVGKECRSRWSPYH 93 >ref|WP_073990125.1| hypothetical protein [Enterococcus faecium] Length = 94 Score = 53.1 bits (126), Expect = 2e-06 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = -1 Query: 427 FNDTATTEIYTLSLHDALPIW--GPTNQQPPKQAE 329 FNDTATTEIYTLSLHDALPIW PTN+ P + E Sbjct: 12 FNDTATTEIYTLSLHDALPIWIHTPTNELPVNRDE 46 >ref|WP_073990085.1| hypothetical protein [Enterococcus faecium] Length = 70 Score = 50.8 bits (120), Expect = 9e-06 Identities = 23/30 (76%), Positives = 25/30 (83%), Gaps = 2/30 (6%) Frame = +1 Query: 340 LGVVG--LLGPRSEERRVGKECRSRWSPYH 423 L ++G LL P SEERRVGKECRSRWSPYH Sbjct: 41 LAIIGRYLLTPESEERRVGKECRSRWSPYH 70 >ref|WP_073495518.1| hypothetical protein [Enterococcus faecalis] Length = 72 Score = 50.8 bits (120), Expect = 9e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 334 PVLGVVGLLGPRSEERRVGKECRSRWSPYH 423 PV V + PRSEERRVGKECRSRWSPYH Sbjct: 43 PVYKVFVISIPRSEERRVGKECRSRWSPYH 72