BLASTX nr result
ID: Ophiopogon22_contig00039554
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00039554 (466 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK76568.1| uncharacterized protein A4U43_C03F29670 [Asparagu... 54 9e-07 >gb|ONK76568.1| uncharacterized protein A4U43_C03F29670 [Asparagus officinalis] Length = 79 Score = 53.9 bits (128), Expect = 9e-07 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = -1 Query: 253 EENMRIHLAGPRRLLQKTFGFRTKPCDPSINYC 155 EEN +IH AGPR++LQ++ +RT+PCDPSI YC Sbjct: 47 EENAQIHFAGPRKMLQQSSYYRTRPCDPSIQYC 79