BLASTX nr result
ID: Ophiopogon22_contig00038736
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00038736 (455 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020268966.1| NRR repressor homolog 3-like [Asparagus offi... 58 5e-08 >ref|XP_020268966.1| NRR repressor homolog 3-like [Asparagus officinalis] Length = 120 Score = 58.2 bits (139), Expect = 5e-08 Identities = 29/67 (43%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Frame = +1 Query: 166 LVSDVKAMRDLWRANNRQKRARFERSTSSPRSTSLWKPTFEWEDFQEVVEI-KNPVKDAN 342 L+ ++KAMR++W+AN K++R E SLW+P FE EDF E +I NP K+ Sbjct: 42 LIGNIKAMREVWKANESNKKSRKE------TLASLWRPKFELEDFYEEAKISNNPGKEVE 95 Query: 343 AKKEDGE 363 K+E+GE Sbjct: 96 GKEEEGE 102