BLASTX nr result
ID: Ophiopogon22_contig00036217
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00036217 (450 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020249596.1| F-box/kelch-repeat protein At1g57790-like [A... 65 2e-09 gb|ONK55671.1| uncharacterized protein A4U43_UnF240 [Asparagus o... 65 2e-09 >ref|XP_020249596.1| F-box/kelch-repeat protein At1g57790-like [Asparagus officinalis] Length = 498 Score = 65.5 bits (158), Expect = 2e-09 Identities = 37/74 (50%), Positives = 41/74 (55%), Gaps = 7/74 (9%) Frame = +1 Query: 241 ILERLALSDYVRFPAVCRQWRSIQRAHRLRHSPRQPPMRPLPWFI-------LSPRVCYS 399 IL+RL +SD VRF AVCR W SIQR H P P + LP I + CYS Sbjct: 49 ILDRLPISDQVRFGAVCRAWLSIQRDQYHGHVPPLPRLLRLPLLIPPQQEQQEATMACYS 108 Query: 400 PLEQRLYRFHHSTP 441 P EQR YRFH S P Sbjct: 109 PFEQRFYRFHLSFP 122 >gb|ONK55671.1| uncharacterized protein A4U43_UnF240 [Asparagus officinalis] Length = 679 Score = 65.5 bits (158), Expect = 2e-09 Identities = 37/74 (50%), Positives = 41/74 (55%), Gaps = 7/74 (9%) Frame = +1 Query: 241 ILERLALSDYVRFPAVCRQWRSIQRAHRLRHSPRQPPMRPLPWFI-------LSPRVCYS 399 IL+RL +SD VRF AVCR W SIQR H P P + LP I + CYS Sbjct: 261 ILDRLPISDQVRFGAVCRAWLSIQRDQYHGHVPPLPRLLRLPLLIPPQQEQQEATMACYS 320 Query: 400 PLEQRLYRFHHSTP 441 P EQR YRFH S P Sbjct: 321 PFEQRFYRFHLSFP 334