BLASTX nr result
ID: Ophiopogon22_contig00036019
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00036019 (488 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266680.1| LOW QUALITY PROTEIN: fasciclin-like arabinog... 76 4e-13 gb|PKA59816.1| Fasciclin-like arabinogalactan protein 2 [Apostas... 74 2e-12 ref|XP_008788906.2| PREDICTED: fasciclin-like arabinogalactan pr... 74 2e-12 ref|XP_010943291.1| PREDICTED: fasciclin-like arabinogalactan pr... 74 2e-12 ref|XP_020590486.1| fasciclin-like arabinogalactan protein 2 [Ph... 70 5e-11 ref|XP_020691694.1| fasciclin-like arabinogalactan protein 2 [De... 69 1e-10 ref|XP_015958926.1| fasciclin-like arabinogalactan protein 1 [Ar... 65 5e-10 ref|XP_016178656.1| fasciclin-like arabinogalactan protein 1 [Ar... 65 6e-10 ref|XP_010928138.1| PREDICTED: fasciclin-like arabinogalactan pr... 67 6e-10 ref|XP_008809683.1| PREDICTED: fasciclin-like arabinogalactan pr... 66 2e-09 ref|XP_023536319.1| fasciclin-like arabinogalactan protein 1 [Cu... 66 2e-09 ref|XP_022975855.1| fasciclin-like arabinogalactan protein 1 [Cu... 66 2e-09 ref|XP_022937170.1| fasciclin-like arabinogalactan protein 1 [Cu... 66 2e-09 ref|XP_008463001.1| PREDICTED: fasciclin-like arabinogalactan pr... 65 2e-09 ref|XP_004148925.1| PREDICTED: fasciclin-like arabinogalactan pr... 65 2e-09 ref|XP_009379991.1| PREDICTED: fasciclin-like arabinogalactan pr... 65 3e-09 gb|PON94014.1| FAS1 domain containing protein [Trema orientalis] 65 3e-09 ref|XP_016174172.1| fasciclin-like arabinogalactan protein 1 [Ar... 65 3e-09 ref|XP_015935471.1| fasciclin-like arabinogalactan protein 1 [Ar... 65 4e-09 ref|XP_016173804.1| fasciclin-like arabinogalactan protein 1 [Ar... 65 4e-09 >ref|XP_020266680.1| LOW QUALITY PROTEIN: fasciclin-like arabinogalactan protein 2 [Asparagus officinalis] Length = 367 Score = 75.9 bits (185), Expect = 4e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 GEVVTL+T+VTTA VTGTLVDEDPLAVYTIDEVLEPRELF Sbjct: 289 GEVVTLKTKVTTARVTGTLVDEDPLAVYTIDEVLEPRELF 328 >gb|PKA59816.1| Fasciclin-like arabinogalactan protein 2 [Apostasia shenzhenica] Length = 426 Score = 74.3 bits (181), Expect = 2e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 GEVVTLRT+VTTA +TGTL+DEDPLAVYTID VLEPRELF Sbjct: 296 GEVVTLRTKVTTAKITGTLIDEDPLAVYTIDAVLEPRELF 335 >ref|XP_008788906.2| PREDICTED: fasciclin-like arabinogalactan protein 2 [Phoenix dactylifera] Length = 409 Score = 73.9 bits (180), Expect = 2e-12 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 GEVVTL+TRVT A++TGTL+DEDPLAVYTID+VLEPRELF Sbjct: 292 GEVVTLKTRVTVATITGTLIDEDPLAVYTIDQVLEPRELF 331 >ref|XP_010943291.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Elaeis guineensis] Length = 412 Score = 73.9 bits (180), Expect = 2e-12 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 GEVVTL+TRVT A++TGTL+DEDPLAVYTID+VLEPRELF Sbjct: 293 GEVVTLKTRVTVATITGTLIDEDPLAVYTIDQVLEPRELF 332 >ref|XP_020590486.1| fasciclin-like arabinogalactan protein 2 [Phalaenopsis equestris] Length = 386 Score = 70.1 bits (170), Expect = 5e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 GEVVTLRT+V TA +TGTL+DEDPLAVYTID VL+PRELF Sbjct: 294 GEVVTLRTKVDTAKITGTLIDEDPLAVYTIDVVLKPRELF 333 >ref|XP_020691694.1| fasciclin-like arabinogalactan protein 2 [Dendrobium catenatum] gb|PKU87549.1| Fasciclin-like arabinogalactan protein 2 [Dendrobium catenatum] Length = 421 Score = 68.9 bits (167), Expect = 1e-10 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 GEVVTL+T+V TA +TGTL+DEDPLAVYTID VL+PRELF Sbjct: 294 GEVVTLKTKVDTAKITGTLIDEDPLAVYTIDVVLKPRELF 333 >ref|XP_015958926.1| fasciclin-like arabinogalactan protein 1 [Arachis duranensis] Length = 161 Score = 64.7 bits (156), Expect = 5e-10 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 G+ VTL+T++ TA +TGTL+DEDPLA+YTID+VL PRELF Sbjct: 33 GDQVTLKTKIVTAKITGTLIDEDPLAIYTIDKVLLPRELF 72 >ref|XP_016178656.1| fasciclin-like arabinogalactan protein 1 [Arachis ipaensis] Length = 170 Score = 64.7 bits (156), Expect = 6e-10 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 G+ VTL+T++ TA +TGTL+DEDPLA+YTID+VL PRELF Sbjct: 42 GDQVTLKTKIVTAKITGTLIDEDPLAIYTIDKVLLPRELF 81 >ref|XP_010928138.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Elaeis guineensis] Length = 399 Score = 67.0 bits (162), Expect = 6e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 GEVVTL+T V A +TGTL+DEDPLAVYTID VLEPRELF Sbjct: 290 GEVVTLKTPVMLAKITGTLIDEDPLAVYTIDAVLEPRELF 329 >ref|XP_008809683.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Phoenix dactylifera] Length = 410 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 GEVVTL+T V A++TGTL+DEDPLAVY ID VLEPRELF Sbjct: 294 GEVVTLKTTVMVATITGTLIDEDPLAVYMIDAVLEPRELF 333 >ref|XP_023536319.1| fasciclin-like arabinogalactan protein 1 [Cucurbita pepo subsp. pepo] Length = 415 Score = 65.9 bits (159), Expect = 2e-09 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 GEVVTL+T+V TA VTGTL+DE P+A+YTID+VL+PRELF Sbjct: 293 GEVVTLQTKVVTAKVTGTLLDEQPVAIYTIDKVLKPRELF 332 >ref|XP_022975855.1| fasciclin-like arabinogalactan protein 1 [Cucurbita maxima] Length = 415 Score = 65.9 bits (159), Expect = 2e-09 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 GEVVTL+T+V TA VTGTL+DE P+A+YTID+VL+PRELF Sbjct: 293 GEVVTLQTKVVTAKVTGTLLDEQPVAIYTIDKVLKPRELF 332 >ref|XP_022937170.1| fasciclin-like arabinogalactan protein 1 [Cucurbita moschata] Length = 415 Score = 65.9 bits (159), Expect = 2e-09 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 GEVVTL+T+V TA VTGTL+DE P+A+YTID+VL+PRELF Sbjct: 293 GEVVTLQTKVVTAKVTGTLLDEQPVAIYTIDKVLKPRELF 332 >ref|XP_008463001.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Cucumis melo] Length = 414 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/40 (72%), Positives = 37/40 (92%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 GEVVTL+T+V TA +TGTL+DE P+A+YTID+VL+PRELF Sbjct: 294 GEVVTLQTKVVTAKITGTLLDEQPVAIYTIDKVLKPRELF 333 >ref|XP_004148925.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Cucumis sativus] gb|KGN44020.1| Fasciclin-like arabinogalactan protein 11 [Cucumis sativus] Length = 415 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/40 (72%), Positives = 37/40 (92%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 GEVVTL+T+V TA +TGTL+DE P+A+YTID+VL+PRELF Sbjct: 294 GEVVTLQTKVVTAKITGTLLDEQPVAIYTIDKVLKPRELF 333 >ref|XP_009379991.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Musa acuminata subsp. malaccensis] Length = 408 Score = 65.1 bits (157), Expect = 3e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 G VTLRTRVT A++ GTL+DEDPLAVYTID+VLEP ELF Sbjct: 293 GNQVTLRTRVTVATLMGTLIDEDPLAVYTIDKVLEPMELF 332 >gb|PON94014.1| FAS1 domain containing protein [Trema orientalis] Length = 422 Score = 65.1 bits (157), Expect = 3e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 GEVVTLRT+V TA +TGTL+DE P+A+YT+D+VL PRELF Sbjct: 298 GEVVTLRTKVVTARITGTLLDEQPVAIYTVDKVLMPRELF 337 >ref|XP_016174172.1| fasciclin-like arabinogalactan protein 1 [Arachis ipaensis] Length = 325 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 G+ VTL+T++ TA +TGTL+DEDPLA+YTID+VL PRELF Sbjct: 197 GDQVTLKTKIVTAKITGTLIDEDPLAIYTIDKVLLPRELF 236 >ref|XP_015935471.1| fasciclin-like arabinogalactan protein 1 [Arachis duranensis] Length = 421 Score = 64.7 bits (156), Expect = 4e-09 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 G+ VTL+T++ TA +TGTL+DEDPLA+YTID+VL PRELF Sbjct: 294 GDQVTLKTKIVTAKITGTLIDEDPLAIYTIDKVLLPRELF 333 >ref|XP_016173804.1| fasciclin-like arabinogalactan protein 1 [Arachis ipaensis] Length = 422 Score = 64.7 bits (156), Expect = 4e-09 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -1 Query: 488 GEVVTLRTRVTTASVTGTLVDEDPLAVYTIDEVLEPRELF 369 G+ VTL+T++ TA +TGTL+DEDPLA+YTID+VL PRELF Sbjct: 294 GDQVTLKTKIVTAKITGTLIDEDPLAIYTIDKVLLPRELF 333