BLASTX nr result
ID: Ophiopogon22_contig00034820
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00034820 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241415.1| pentatricopeptide repeat-containing protein ... 70 2e-11 >ref|XP_020241415.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] ref|XP_020241416.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] ref|XP_020241417.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] ref|XP_020241418.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] ref|XP_020241420.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] ref|XP_020241421.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] ref|XP_020241422.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] ref|XP_020241423.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] gb|ONK60141.1| uncharacterized protein A4U43_C08F14820 [Asparagus officinalis] Length = 629 Score = 70.5 bits (171), Expect = 2e-11 Identities = 39/83 (46%), Positives = 49/83 (59%), Gaps = 18/83 (21%) Frame = -3 Query: 382 PSFYLVSQNRVQDAFTLYFRIRSLSSAQGLHSIIASLPFS------------------HA 257 P L +QNR+Q+AF+L R RSLSSA L S+I++LP S HA Sbjct: 17 PITNLFTQNRIQEAFSLCLRTRSLSSAHKLRSLISTLPHSITLTNRLIDLYSKCGSPSHA 76 Query: 256 HKLFDKMPARDLCSYNTLVKVKS 188 +FD+MP RDLCSYNTL+K S Sbjct: 77 RNMFDEMPTRDLCSYNTLIKAYS 99