BLASTX nr result
ID: Ophiopogon22_contig00034799
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00034799 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB06145.1| hypothetical protein B456_001G004700 [Gossypium r... 58 1e-08 gb|PLY91538.1| hypothetical protein LSAT_5X101501 [Lactuca sativa] 56 4e-08 gb|PRQ46588.1| hypothetical protein RchiOBHm_Chr2g0090641 [Rosa ... 57 4e-08 gb|ERN07866.1| hypothetical protein AMTR_s00012p00214100 [Ambore... 57 5e-08 gb|OUZ99927.1| hypothetical protein BVC80_9069g35 [Macleaya cord... 56 5e-08 gb|PIA65068.1| hypothetical protein AQUCO_00100507v1 [Aquilegia ... 56 8e-08 gb|EOY30820.1| Uncharacterized protein TCM_037899 [Theobroma cacao] 56 1e-07 ref|XP_024006303.1| putative protein TPRXL [Eutrema salsugineum] 55 2e-07 gb|OAY53734.1| hypothetical protein MANES_03G019500 [Manihot esc... 54 4e-07 gb|ONH98110.1| hypothetical protein PRUPE_7G229700 [Prunus persica] 54 7e-07 gb|POE57172.1| hypothetical protein CFP56_01828 [Quercus suber] 54 1e-06 gb|EEF48276.1| conserved hypothetical protein [Ricinus communis] 53 1e-06 ref|XP_009107136.1| PREDICTED: uncharacterized protein LOC103832... 53 1e-06 ref|XP_013626551.1| PREDICTED: uncharacterized protein LOC106332... 53 1e-06 ref|XP_013724791.1| uncharacterized protein BNAC03G69280D [Brass... 53 1e-06 ref|XP_022846371.1| uncharacterized protein LOC111369102 [Olea e... 53 1e-06 ref|XP_013721379.1| uncharacterized protein LOC106425203 [Brassi... 53 1e-06 ref|XP_013590689.1| PREDICTED: uncharacterized protein LOC106299... 53 1e-06 gb|OMO90070.1| hypothetical protein CCACVL1_07524 [Corchorus cap... 52 2e-06 ref|XP_018466604.1| PREDICTED: uncharacterized protein LOC108838... 53 2e-06 >gb|KJB06145.1| hypothetical protein B456_001G004700 [Gossypium raimondii] Length = 73 Score = 58.2 bits (139), Expect = 1e-08 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -3 Query: 137 GVAAVRQCVCSPTRHPRSFRCRQHHHLYQWGGK 39 GV +++QC+CSPT+HP SFRCR HH Y WGG+ Sbjct: 36 GVGSMKQCLCSPTKHPGSFRCRHHHAEYVWGGR 68 >gb|PLY91538.1| hypothetical protein LSAT_5X101501 [Lactuca sativa] Length = 54 Score = 56.2 bits (134), Expect = 4e-08 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = -3 Query: 128 AVRQCVCSPTRHPRSFRCRQHHHLYQWGGK 39 +++QC+CSPT HP SFRCRQHH+ Y WGG+ Sbjct: 17 SLQQCLCSPTTHPGSFRCRQHHNKYVWGGR 46 >gb|PRQ46588.1| hypothetical protein RchiOBHm_Chr2g0090641 [Rosa chinensis] Length = 100 Score = 57.4 bits (137), Expect = 4e-08 Identities = 25/43 (58%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = -3 Query: 137 GVAAVRQCVCSPTRHPRSFRCRQHH-HLYQWGGKAAVEN*KKT 12 G R+CVCSPTRHP SFRCRQHH Y WGG+ N T Sbjct: 57 GGGGARRCVCSPTRHPGSFRCRQHHADQYVWGGRTVTRNRSST 99 >gb|ERN07866.1| hypothetical protein AMTR_s00012p00214100 [Amborella trichopoda] Length = 98 Score = 57.0 bits (136), Expect = 5e-08 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = -3 Query: 116 CVCSPTRHPRSFRCRQHHHLYQWGGKAAVEN 24 C+CSPTRHP SFRCR HH YQWG K E+ Sbjct: 63 CICSPTRHPGSFRCRYHHKYYQWGSKRTTED 93 >gb|OUZ99927.1| hypothetical protein BVC80_9069g35 [Macleaya cordata] Length = 57 Score = 55.8 bits (133), Expect = 5e-08 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -3 Query: 137 GVAAVRQCVCSPTRHPRSFRCRQHHHLYQWGGK 39 G A +RQC+CSPT+HP SFRCR H Y+WGG+ Sbjct: 18 GGAMMRQCLCSPTQHPGSFRCRHHQSEYEWGGR 50 >gb|PIA65068.1| hypothetical protein AQUCO_00100507v1 [Aquilegia coerulea] Length = 88 Score = 56.2 bits (134), Expect = 8e-08 Identities = 23/33 (69%), Positives = 27/33 (81%), Gaps = 2/33 (6%) Frame = -3 Query: 137 GVAAV--RQCVCSPTRHPRSFRCRQHHHLYQWG 45 GVA + +QC+CSPT+HP SFRCRQHH YQWG Sbjct: 53 GVAGLISKQCLCSPTKHPGSFRCRQHHSEYQWG 85 >gb|EOY30820.1| Uncharacterized protein TCM_037899 [Theobroma cacao] Length = 84 Score = 55.8 bits (133), Expect = 1e-07 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = -3 Query: 137 GVAAVRQCVCSPTRHPRSFRCRQHHHLYQWGGK 39 G +++QC+CSPT+HP SFRCR HH Y WGG+ Sbjct: 47 GSTSMKQCLCSPTKHPGSFRCRHHHAEYVWGGR 79 >ref|XP_024006303.1| putative protein TPRXL [Eutrema salsugineum] Length = 106 Score = 55.5 bits (132), Expect = 2e-07 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = -3 Query: 137 GVAAVRQCVCSPTRHPRSFRCRQHHHLYQW 48 G ++CVCSP++HPRSFRCR HHH YQW Sbjct: 40 GGGGKKRCVCSPSKHPRSFRCRYHHHEYQW 69 >gb|OAY53734.1| hypothetical protein MANES_03G019500 [Manihot esculenta] Length = 80 Score = 54.3 bits (129), Expect = 4e-07 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = -3 Query: 137 GVAAVRQCVCSPTRHPRSFRCRQHHHLYQWG 45 G ++++CVCSPTRHP SFRCR HH Y+WG Sbjct: 44 GGGSMKKCVCSPTRHPGSFRCRHHHGDYEWG 74 >gb|ONH98110.1| hypothetical protein PRUPE_7G229700 [Prunus persica] Length = 109 Score = 54.3 bits (129), Expect = 7e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -3 Query: 122 RQCVCSPTRHPRSFRCRQHHHLYQWG 45 RQC+CSPTRHP SFRCRQHH Y WG Sbjct: 72 RQCLCSPTRHPGSFRCRQHHAGYVWG 97 >gb|POE57172.1| hypothetical protein CFP56_01828 [Quercus suber] Length = 98 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/38 (60%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -3 Query: 137 GVAAVRQCVCSPTRHPRSFRCRQHHHL-YQWGGKAAVE 27 G +++QCVCSPT HP SFRCRQHH Y WGG+ E Sbjct: 56 GGGSLKQCVCSPTGHPGSFRCRQHHAAGYVWGGRVLRE 93 >gb|EEF48276.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 53.1 bits (126), Expect = 1e-06 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -3 Query: 137 GVAAVRQCVCSPTRHPRSFRCRQHHHLYQWG 45 G +++ CVCSPTRHP SFRCR HH Y WG Sbjct: 54 GGGSIKMCVCSPTRHPGSFRCRHHHVDYAWG 84 >ref|XP_009107136.1| PREDICTED: uncharacterized protein LOC103832796 [Brassica rapa] Length = 78 Score = 52.8 bits (125), Expect = 1e-06 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -3 Query: 122 RQCVCSPTRHPRSFRCRQHHHLYQW 48 ++CVCSP+ HPRSF+CR HHH YQW Sbjct: 46 KKCVCSPSTHPRSFKCRYHHHEYQW 70 >ref|XP_013626551.1| PREDICTED: uncharacterized protein LOC106332614 [Brassica oleracea var. oleracea] Length = 79 Score = 52.8 bits (125), Expect = 1e-06 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -3 Query: 122 RQCVCSPTRHPRSFRCRQHHHLYQW 48 ++CVCSP+ HPRSF+CR HHH YQW Sbjct: 46 KKCVCSPSTHPRSFKCRYHHHEYQW 70 >ref|XP_013724791.1| uncharacterized protein BNAC03G69280D [Brassica napus] emb|CDY47534.1| BnaC03g69280D [Brassica napus] Length = 79 Score = 52.8 bits (125), Expect = 1e-06 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -3 Query: 122 RQCVCSPTRHPRSFRCRQHHHLYQW 48 ++CVCSP+ HPRSF+CR HHH YQW Sbjct: 46 KKCVCSPSTHPRSFKCRYHHHEYQW 70 >ref|XP_022846371.1| uncharacterized protein LOC111369102 [Olea europaea var. sylvestris] Length = 95 Score = 53.1 bits (126), Expect = 1e-06 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = -3 Query: 137 GVAAVRQCVCSPTRHPRSFRCRQHHHLYQWGGK 39 G +R+CVCSPT HP SFRCR HH Y+W G+ Sbjct: 57 GGGGMRRCVCSPTNHPGSFRCRHHHAEYEWVGR 89 >ref|XP_013721379.1| uncharacterized protein LOC106425203 [Brassica napus] Length = 81 Score = 52.8 bits (125), Expect = 1e-06 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -3 Query: 116 CVCSPTRHPRSFRCRQHHHLYQW 48 CVCSP++HPRSF+CR HHH YQW Sbjct: 43 CVCSPSKHPRSFKCRYHHHEYQW 65 >ref|XP_013590689.1| PREDICTED: uncharacterized protein LOC106299096 [Brassica oleracea var. oleracea] Length = 81 Score = 52.8 bits (125), Expect = 1e-06 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -3 Query: 116 CVCSPTRHPRSFRCRQHHHLYQW 48 CVCSP++HPRSF+CR HHH YQW Sbjct: 43 CVCSPSKHPRSFKCRYHHHEYQW 65 >gb|OMO90070.1| hypothetical protein CCACVL1_07524 [Corchorus capsularis] Length = 68 Score = 52.4 bits (124), Expect = 2e-06 Identities = 19/33 (57%), Positives = 25/33 (75%) Frame = -3 Query: 137 GVAAVRQCVCSPTRHPRSFRCRQHHHLYQWGGK 39 G +++QC+CSPT+HP SFRCR H Y WGG+ Sbjct: 31 GGGSMKQCLCSPTKHPGSFRCRHHQGEYVWGGR 63 >ref|XP_018466604.1| PREDICTED: uncharacterized protein LOC108838131 [Raphanus sativus] Length = 83 Score = 52.8 bits (125), Expect = 2e-06 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -3 Query: 116 CVCSPTRHPRSFRCRQHHHLYQW 48 CVCSP++HPRSF+CR HHH YQW Sbjct: 43 CVCSPSKHPRSFKCRYHHHEYQW 65