BLASTX nr result
ID: Ophiopogon22_contig00034739
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00034739 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK77140.1| uncharacterized protein A4U43_C02F3510 [Asparagus... 60 1e-08 >gb|ONK77140.1| uncharacterized protein A4U43_C02F3510 [Asparagus officinalis] Length = 152 Score = 60.1 bits (144), Expect = 1e-08 Identities = 33/84 (39%), Positives = 46/84 (54%) Frame = -1 Query: 385 KVYTAGCESFGVFDLNTSSGQLLCSHPKSTAICKSSAVWISPGLLYRDREPSWRVKFCNV 206 +VYTAG ESFG+ DL + G++ C H CK + W+ P LL+RDR+P W N+ Sbjct: 46 RVYTAGEESFGMLDLRSGEGRICCDHDDE---CKMNNFWVMPELLFRDRDPKWWAALYNM 102 Query: 205 ARFWLAIFGIIAVVFAGALLIVFT 134 L + AV+F LL F+ Sbjct: 103 NDQLLD--RVYAVLFVLLLLSSFS 124