BLASTX nr result
ID: Ophiopogon22_contig00034298
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00034298 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020270045.1| pentatricopeptide repeat-containing protein ... 75 3e-13 gb|ONK66118.1| uncharacterized protein A4U43_C06F4330 [Asparagus... 75 4e-13 gb|ONK61171.1| uncharacterized protein A4U43_C08F26960 [Asparagu... 44 1e-07 ref|XP_010917211.1| PREDICTED: pentatricopeptide repeat-containi... 56 2e-06 ref|XP_008786659.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 >ref|XP_020270045.1| pentatricopeptide repeat-containing protein At2g06000-like [Asparagus officinalis] Length = 418 Score = 75.5 bits (184), Expect = 3e-13 Identities = 39/53 (73%), Positives = 45/53 (84%) Frame = +1 Query: 1 INTIVSLLFKAGMPGEAKRIMELASGKDTGSDVSPSKEIPSLLTKGANVSVAV 159 +N VSLL KAGMP EAKRI+E+ASGK+ G D+S SKEIPSLLTK A+VSVAV Sbjct: 366 VNNFVSLLLKAGMPSEAKRIVEIASGKNMGLDLSLSKEIPSLLTKRADVSVAV 418 >gb|ONK66118.1| uncharacterized protein A4U43_C06F4330 [Asparagus officinalis] Length = 550 Score = 75.5 bits (184), Expect = 4e-13 Identities = 39/53 (73%), Positives = 45/53 (84%) Frame = +1 Query: 1 INTIVSLLFKAGMPGEAKRIMELASGKDTGSDVSPSKEIPSLLTKGANVSVAV 159 +N VSLL KAGMP EAKRI+E+ASGK+ G D+S SKEIPSLLTK A+VSVAV Sbjct: 498 VNNFVSLLLKAGMPSEAKRIVEIASGKNMGLDLSLSKEIPSLLTKRADVSVAV 550 >gb|ONK61171.1| uncharacterized protein A4U43_C08F26960 [Asparagus officinalis] Length = 244 Score = 44.3 bits (103), Expect(2) = 1e-07 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = +1 Query: 1 INTIVSLLFKAGMPGEAKRIMELASGKDTG 90 +NT + LLFK+GMP EA RIM +A GK+TG Sbjct: 189 VNTFILLLFKSGMPSEANRIMNIALGKNTG 218 Score = 38.9 bits (89), Expect(2) = 1e-07 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = +3 Query: 66 ISIREGYWIGCITIEGNSFIINKGCKCFSCRIVS 167 I++ + C+ IEG+SFII+K C+C SC I S Sbjct: 211 IALGKNTGFACVDIEGSSFIIDKECRCLSCCIAS 244 >ref|XP_010917211.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000 [Elaeis guineensis] Length = 544 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/53 (49%), Positives = 39/53 (73%) Frame = +1 Query: 1 INTIVSLLFKAGMPGEAKRIMELASGKDTGSDVSPSKEIPSLLTKGANVSVAV 159 ++++VS L KAG+P E RIM +ASG+D G D+S SKE PS L + +++VA+ Sbjct: 492 VSSLVSCLLKAGLPNEVNRIMLIASGRDLGLDISSSKESPSSLGQSPDITVAM 544 >ref|XP_008786659.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Phoenix dactylifera] ref|XP_017696173.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Phoenix dactylifera] Length = 546 Score = 54.7 bits (130), Expect = 6e-06 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = +1 Query: 1 INTIVSLLFKAGMPGEAKRIMELASGKDTGSDVSPSKEIPSLLTKGANVSVAV 159 ++++VS L KAG+P E RIM +A G+D G D+S S+E PS L K ++SV V Sbjct: 494 VSSLVSCLLKAGLPNEVNRIMLIAWGRDLGLDISSSEESPSSLRKSLDISVVV 546