BLASTX nr result
ID: Ophiopogon22_contig00034264
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00034264 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245344.1| uncharacterized protein LOC109823472 [Aspara... 56 2e-06 >ref|XP_020245344.1| uncharacterized protein LOC109823472 [Asparagus officinalis] Length = 192 Score = 55.8 bits (133), Expect = 2e-06 Identities = 30/55 (54%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -3 Query: 165 MIITSLNIRGIGCPLKRRHLRDFLRLHWTDILLLQESKITDPT-RLLRSLDGRVL 4 M TS N+RG+ PLKRR ++DFL H D+ LQESK++DPT R L+S+ GR L Sbjct: 1 MKFTSWNVRGLNDPLKRRLVKDFLSSHLIDVAGLQESKLSDPTPRKLQSIGGRRL 55