BLASTX nr result
ID: Ophiopogon22_contig00034091
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00034091 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020269097.1| probable RNA-dependent RNA polymerase 1 [Asp... 62 1e-08 >ref|XP_020269097.1| probable RNA-dependent RNA polymerase 1 [Asparagus officinalis] ref|XP_020269098.1| probable RNA-dependent RNA polymerase 1 [Asparagus officinalis] gb|ONK67125.1| uncharacterized protein A4U43_C06F15970 [Asparagus officinalis] Length = 1128 Score = 62.0 bits (149), Expect = 1e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 255 MGGKTVQVSGFPMNVTAEGVKNFLENYTGDGSVF 356 MG KTV VSGFPMNVTA+ VKNFLE+YTG+GSVF Sbjct: 1 MGSKTVHVSGFPMNVTADSVKNFLEDYTGEGSVF 34