BLASTX nr result
ID: Ophiopogon22_contig00032093
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00032093 (505 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK64270.1| uncharacterized protein A4U43_C07F23890, partial ... 60 2e-07 ref|XP_020273832.1| protein S-acyltransferase 11 [Asparagus offi... 60 2e-07 ref|XP_021689331.1| probable LRR receptor-like serine/threonine-... 40 3e-06 >gb|ONK64270.1| uncharacterized protein A4U43_C07F23890, partial [Asparagus officinalis] Length = 340 Score = 60.1 bits (144), Expect = 2e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 504 HGDKGCHNLLRFFGCPYSAFRFLLGP 427 +GDKGCHNLLRFFGCPYSAFRF+LGP Sbjct: 300 NGDKGCHNLLRFFGCPYSAFRFVLGP 325 >ref|XP_020273832.1| protein S-acyltransferase 11 [Asparagus officinalis] Length = 347 Score = 60.1 bits (144), Expect = 2e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 504 HGDKGCHNLLRFFGCPYSAFRFLLGP 427 +GDKGCHNLLRFFGCPYSAFRF+LGP Sbjct: 307 NGDKGCHNLLRFFGCPYSAFRFVLGP 332 >ref|XP_021689331.1| probable LRR receptor-like serine/threonine-protein kinase At3g47570 [Hevea brasiliensis] Length = 1028 Score = 40.0 bits (92), Expect(2) = 3e-06 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = +2 Query: 197 FTYEC*SSRNVRHRSLVKIIPSCSRVDF 280 F EC + RN+RHR+LVKI+ +CS VDF Sbjct: 762 FIAECEALRNIRHRNLVKILTACSSVDF 789 Score = 38.5 bits (88), Expect(2) = 3e-06 Identities = 28/65 (43%), Positives = 36/65 (55%) Frame = +1 Query: 1 SLEIFPAQVSYAELQRATCGFSSS*ADW*RKLYDCVYK*EYVCNEEIVAVKVLHTQTEEM 180 S E P +VSY + +AT GFSSS + CVYK ++ E VAVKVL+ Q + Sbjct: 700 SNEDSPQRVSYRSILKATDGFSSSNLIG-SGSFGCVYKAKFDQEESPVAVKVLNLQRQGA 758 Query: 181 FASQI 195 F S I Sbjct: 759 FKSFI 763