BLASTX nr result
ID: Ophiopogon22_contig00031462
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00031462 (528 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256316.1| riboflavin biosynthesis protein PYRD, chloro... 64 1e-08 ref|XP_020093111.1| riboflavin biosynthesis protein PYRD, chloro... 60 2e-07 gb|OAY81013.1| Riboflavin biosynthesis protein PYRD, chloroplast... 60 2e-07 ref|XP_020093110.1| riboflavin biosynthesis protein PYRD, chloro... 60 2e-07 ref|XP_020676687.1| riboflavin biosynthesis protein PYRD, chloro... 58 1e-06 >ref|XP_020256316.1| riboflavin biosynthesis protein PYRD, chloroplastic [Asparagus officinalis] gb|ONK74530.1| uncharacterized protein A4U43_C03F7320 [Asparagus officinalis] Length = 410 Score = 63.5 bits (153), Expect = 1e-08 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -1 Query: 483 VQKVLMELCPVLVGNEQPSNLKFGRKLLRLTDLKSTISNESVIVEGYIS 337 VQKV+MELCPVL N++ S L FG+K L L DL+ +SN+SVIVEGYIS Sbjct: 362 VQKVVMELCPVLDRNQESSILTFGKKSLSLRDLQLRVSNDSVIVEGYIS 410 >ref|XP_020093111.1| riboflavin biosynthesis protein PYRD, chloroplastic isoform X2 [Ananas comosus] Length = 395 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = -1 Query: 483 VQKVLMELCPVLVGNEQPSNLKFGRKLLRLTDLKSTISNESVIVEGYIS 337 VQKV+ME+CPV G+++ S L FG K LRL +L+S + +ESV+VEGYIS Sbjct: 347 VQKVIMEVCPVWNGSKEASFLAFGEKSLRLNNLQSRVYSESVVVEGYIS 395 >gb|OAY81013.1| Riboflavin biosynthesis protein PYRD, chloroplastic [Ananas comosus] Length = 395 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = -1 Query: 483 VQKVLMELCPVLVGNEQPSNLKFGRKLLRLTDLKSTISNESVIVEGYIS 337 VQKV+ME+CPV G+++ S L FG K LRL +L+S + +ESV+VEGYIS Sbjct: 347 VQKVIMEVCPVWNGSKEASFLAFGEKSLRLNNLQSRVYSESVVVEGYIS 395 >ref|XP_020093110.1| riboflavin biosynthesis protein PYRD, chloroplastic isoform X1 [Ananas comosus] Length = 422 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = -1 Query: 483 VQKVLMELCPVLVGNEQPSNLKFGRKLLRLTDLKSTISNESVIVEGYIS 337 VQKV+ME+CPV G+++ S L FG K LRL +L+S + +ESV+VEGYIS Sbjct: 374 VQKVIMEVCPVWNGSKEASFLAFGEKSLRLNNLQSRVYSESVVVEGYIS 422 >ref|XP_020676687.1| riboflavin biosynthesis protein PYRD, chloroplastic [Dendrobium catenatum] Length = 420 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/49 (53%), Positives = 38/49 (77%) Frame = -1 Query: 483 VQKVLMELCPVLVGNEQPSNLKFGRKLLRLTDLKSTISNESVIVEGYIS 337 VQKV++ELCPV +G+ + S FG +L +L DL+S ++NES +VEGY+S Sbjct: 372 VQKVMVELCPVWIGSSEASVPSFGLELRKLKDLQSNVANESTLVEGYLS 420