BLASTX nr result
ID: Ophiopogon22_contig00031221
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00031221 (391 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020243296.1| uncharacterized protein LOC109821524 [Aspara... 55 3e-06 >ref|XP_020243296.1| uncharacterized protein LOC109821524 [Asparagus officinalis] Length = 802 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/65 (38%), Positives = 37/65 (56%) Frame = +1 Query: 4 PSKIWIGVDDGFWQPIKYERLPYFCVNCCIQGHSQSKCKRNAMALNISRQSSPLERMADV 183 P IWIG+ +GF QP+ YERLP +C C +QGH+ +C + ++ PL + Sbjct: 559 PQFIWIGLYEGFEQPVVYERLPKYCNGCHVQGHASVECSK---PQHVDHLVKPLMHSSKF 615 Query: 184 GLDPL 198 G+D L Sbjct: 616 GIDSL 620