BLASTX nr result
ID: Ophiopogon22_contig00031059
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00031059 (842 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGY62798.1| orf636 (mitochondrion) [Eruca vesicaria subsp. sa... 63 2e-07 >gb|AGY62798.1| orf636 (mitochondrion) [Eruca vesicaria subsp. sativa] Length = 636 Score = 62.8 bits (151), Expect = 2e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 318 ERKIRMRPNGYQQVELMLYLTLSLVGFIPKQDTDSTPLVCLG 443 E + MRPN YQQVELMLYL LSLVGF+PKQ+TDS+P LG Sbjct: 560 EAVLSMRPNEYQQVELMLYLILSLVGFLPKQNTDSSPFTRLG 601