BLASTX nr result
ID: Ophiopogon22_contig00031036
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00031036 (518 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KQK85826.1| hypothetical protein SETIT_020742mg [Setaria ital... 66 1e-12 >gb|KQK85826.1| hypothetical protein SETIT_020742mg [Setaria italica] Length = 74 Score = 66.2 bits (160), Expect(2) = 1e-12 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +3 Query: 372 TRHSLGFWSIIRLCRKDGRVVQGVALELLCRLLVYRG 482 TR+SL FWSIIRLCR+DGRVVQGVALELLCRLL G Sbjct: 16 TRYSLSFWSIIRLCRRDGRVVQGVALELLCRLLFTEG 52 Score = 34.3 bits (77), Expect(2) = 1e-12 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 469 LFTEGSNPSLSVSVNS 516 LFTEGSNPSLSVSVNS Sbjct: 48 LFTEGSNPSLSVSVNS 63