BLASTX nr result
ID: Ophiopogon22_contig00030910
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00030910 (627 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAY65853.1| hypothetical protein CUMW_244220 [Citrus unshiu] 58 4e-06 ref|XP_023523036.1| protein argonaute 10-like, partial [Cucurbit... 53 7e-06 >dbj|GAY65853.1| hypothetical protein CUMW_244220 [Citrus unshiu] Length = 1760 Score = 57.8 bits (138), Expect = 4e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +1 Query: 277 QSLLILQYQVGGRNTIFVDVISCRVPLVCDRPTIMFGANVTY 402 Q L+I+ VGGRNT+ VD + R+PLV DRPTI+FGANVT+ Sbjct: 557 QLLIIILPDVGGRNTVLVDAVQKRIPLVTDRPTIIFGANVTH 598 >ref|XP_023523036.1| protein argonaute 10-like, partial [Cucurbita pepo subsp. pepo] Length = 93 Score = 53.1 bits (126), Expect = 7e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = +1 Query: 304 VGGRNTIFVDVISCRVPLVCDRPTIMFGANVTY 402 +GGRNT+ +D ISCR+PLV D PTI+FGA+VT+ Sbjct: 1 MGGRNTVLLDAISCRIPLVSDIPTIIFGADVTH 33