BLASTX nr result
ID: Ophiopogon22_contig00030847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00030847 (403 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK71846.1| uncharacterized protein A4U43_C04F12990 [Asparagu... 72 1e-12 ref|XP_020262538.1| kinesin-like protein KIN-UA [Asparagus offic... 72 8e-12 gb|PKA62744.1| Armadillo repeat-containing kinesin-like protein ... 59 2e-07 ref|XP_018682227.1| PREDICTED: armadillo repeat-containing kines... 55 5e-06 ref|XP_018682226.1| PREDICTED: armadillo repeat-containing kines... 55 5e-06 >gb|ONK71846.1| uncharacterized protein A4U43_C04F12990 [Asparagus officinalis] Length = 211 Score = 71.6 bits (174), Expect = 1e-12 Identities = 46/86 (53%), Positives = 57/86 (66%), Gaps = 7/86 (8%) Frame = -2 Query: 321 ALLLDLGSS--VITDFTDPDLKLSHHQEQAL-----QDDNTFDIVFAKEIKQLIRISKES 163 +LL++ G+ +I + T H E AL D NTFDIV AK IKQL+RIS+ES Sbjct: 126 SLLIEDGALNWIIANSTAFSTSTRRHIELALCHLAQNDGNTFDIVSAKGIKQLVRISQES 185 Query: 162 SK*DIGNLAKEALDSNPIFSAEHQRL 85 SK DI NLAK+A+DSNPIF AE +RL Sbjct: 186 SKEDIRNLAKKAIDSNPIFLAEIRRL 211 >ref|XP_020262538.1| kinesin-like protein KIN-UA [Asparagus officinalis] Length = 932 Score = 71.6 bits (174), Expect = 8e-12 Identities = 46/86 (53%), Positives = 57/86 (66%), Gaps = 7/86 (8%) Frame = -2 Query: 321 ALLLDLGSS--VITDFTDPDLKLSHHQEQAL-----QDDNTFDIVFAKEIKQLIRISKES 163 +LL++ G+ +I + T H E AL D NTFDIV AK IKQL+RIS+ES Sbjct: 847 SLLIEDGALNWIIANSTAFSTSTRRHIELALCHLAQNDGNTFDIVSAKGIKQLVRISQES 906 Query: 162 SK*DIGNLAKEALDSNPIFSAEHQRL 85 SK DI NLAK+A+DSNPIF AE +RL Sbjct: 907 SKEDIRNLAKKAIDSNPIFLAEIRRL 932 >gb|PKA62744.1| Armadillo repeat-containing kinesin-like protein 1 [Apostasia shenzhenica] Length = 915 Score = 58.9 bits (141), Expect = 2e-07 Identities = 34/73 (46%), Positives = 47/73 (64%), Gaps = 5/73 (6%) Frame = -2 Query: 288 TDFTDPDLKLSHHQEQAL-----QDDNTFDIVFAKEIKQLIRISKESSK*DIGNLAKEAL 124 T F+D HH E AL +DN D++ + +K+L+RIS+ESS+ DI LAK+ L Sbjct: 842 TTFSD---STRHHIELALCHLAQNEDNALDVIKSGGVKELLRISQESSREDICKLAKKVL 898 Query: 123 DSNPIFSAEHQRL 85 SNP+FSAE +RL Sbjct: 899 KSNPVFSAELERL 911 >ref|XP_018682227.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 isoform X2 [Musa acuminata subsp. malaccensis] Length = 945 Score = 55.1 bits (131), Expect = 5e-06 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -2 Query: 240 ALQDDNTFDIVFAKEIKQLIRISKESSK*DIGNLAKEALDSNPIFSAE 97 A +DNT +I+ + IK+LIRIS+ESS+ D NLA +ALDSNP FS E Sbjct: 894 AQNEDNTLEIIRSGGIKELIRISRESSREDTRNLAMKALDSNPAFSTE 941 >ref|XP_018682226.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 isoform X1 [Musa acuminata subsp. malaccensis] Length = 971 Score = 55.1 bits (131), Expect = 5e-06 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -2 Query: 240 ALQDDNTFDIVFAKEIKQLIRISKESSK*DIGNLAKEALDSNPIFSAE 97 A +DNT +I+ + IK+LIRIS+ESS+ D NLA +ALDSNP FS E Sbjct: 920 AQNEDNTLEIIRSGGIKELIRISRESSREDTRNLAMKALDSNPAFSTE 967