BLASTX nr result
ID: Ophiopogon22_contig00030829
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00030829 (603 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244650.1| protein UPSTREAM OF FLC-like [Asparagus offi... 108 2e-24 ref|XP_010937705.1| PREDICTED: protein UPSTREAM OF FLC [Elaeis g... 89 3e-17 ref|XP_010920698.1| PREDICTED: protein UPSTREAM OF FLC-like [Ela... 80 7e-14 gb|PHT68779.1| hypothetical protein T459_28266, partial [Capsicu... 79 9e-14 gb|PHT98074.1| Protein UPSTREAM OF FLC [Capsicum chinense] 79 2e-13 ref|XP_016548468.1| PREDICTED: protein UPSTREAM OF FLC [Capsicum... 79 2e-13 ref|XP_010253296.1| PREDICTED: protein UPSTREAM OF FLC [Nelumbo ... 78 2e-13 gb|PHT34427.1| Protein UPSTREAM OF FLC [Capsicum baccatum] 78 3e-13 ref|XP_007016521.2| PREDICTED: protein UPSTREAM OF FLC [Theobrom... 77 6e-13 gb|EOY34140.1| Domain of Uncharacterized protein function, putat... 77 6e-13 ref|XP_006363367.1| PREDICTED: protein UPSTREAM OF FLC [Solanum ... 76 2e-12 ref|XP_009402338.1| PREDICTED: protein UPSTREAM OF FLC-like [Mus... 75 2e-12 ref|XP_002534353.1| PREDICTED: protein UPSTREAM OF FLC [Ricinus ... 75 2e-12 ref|XP_009403454.1| PREDICTED: protein UPSTREAM OF FLC-like [Mus... 75 4e-12 ref|XP_020087659.1| protein UPSTREAM OF FLC [Ananas comosus] >gi... 75 4e-12 dbj|GAV57882.1| DUF966 domain-containing protein [Cephalotus fol... 75 4e-12 ref|XP_016462372.1| PREDICTED: protein UPSTREAM OF FLC-like [Nic... 75 4e-12 gb|OVA03541.1| Protein of unknown function DUF966 [Macleaya cord... 75 4e-12 ref|XP_023898430.1| protein UPSTREAM OF FLC [Quercus suber] >gi|... 74 5e-12 ref|XP_021279214.1| LOW QUALITY PROTEIN: protein UPSTREAM OF FLC... 74 7e-12 >ref|XP_020244650.1| protein UPSTREAM OF FLC-like [Asparagus officinalis] gb|ONK61920.1| uncharacterized protein A4U43_C08F34930 [Asparagus officinalis] Length = 412 Score = 108 bits (270), Expect = 2e-24 Identities = 53/68 (77%), Positives = 61/68 (89%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 +KEYFSGSLIE+K K SG +GEFS LRRSSSCNAERGLKM+LAEKE++GVR RCIPRRP Sbjct: 324 EKEYFSGSLIELK-KKASGANGEFSSLRRSSSCNAERGLKMELAEKEIDGVRARCIPRRP 382 Query: 181 KATASKKD 204 KATA K++ Sbjct: 383 KATAGKRE 390 >ref|XP_010937705.1| PREDICTED: protein UPSTREAM OF FLC [Elaeis guineensis] Length = 428 Score = 89.4 bits (220), Expect = 3e-17 Identities = 45/69 (65%), Positives = 55/69 (79%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSLIE K KES EF GL+RSSS NA+R K++LAEKE+EGVR +CIPR+P Sbjct: 341 DKEYFSGSLIETK-KKESDGVAEFPGLKRSSSYNADRSSKLELAEKEIEGVRAKCIPRKP 399 Query: 181 KATASKKDL 207 +ATA K+ + Sbjct: 400 RATARKETI 408 >ref|XP_010920698.1| PREDICTED: protein UPSTREAM OF FLC-like [Elaeis guineensis] Length = 430 Score = 79.7 bits (195), Expect = 7e-14 Identities = 42/68 (61%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEV-EGVRTRCIPRR 177 DKEYFSGSLIE K KES EF GL+RSSS NA+R K+++ EKE+ EGVR +CIPR+ Sbjct: 340 DKEYFSGSLIETK-KKESDDVAEFPGLKRSSSYNADRSSKVEVVEKEIDEGVRAKCIPRK 398 Query: 178 PKATASKK 201 P+AT K+ Sbjct: 399 PRATTRKE 406 >gb|PHT68779.1| hypothetical protein T459_28266, partial [Capsicum annuum] Length = 320 Score = 78.6 bits (192), Expect = 9e-14 Identities = 38/70 (54%), Positives = 51/70 (72%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSLIE K E+ L+RSSS NA+R K+++ EKE+EGV+ +CIPRRP Sbjct: 226 DKEYFSGSLIETK-------KDEYPALKRSSSFNADRSAKLEIREKEIEGVKAKCIPRRP 278 Query: 181 KATASKKDLG 210 K +++K+LG Sbjct: 279 KNQSTRKELG 288 >gb|PHT98074.1| Protein UPSTREAM OF FLC [Capsicum chinense] Length = 398 Score = 78.6 bits (192), Expect = 2e-13 Identities = 38/70 (54%), Positives = 51/70 (72%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSLIE K E+ L+RSSS NA+R K+++ EKE+EGV+ +CIPRRP Sbjct: 304 DKEYFSGSLIETK-------KDEYPALKRSSSFNADRSAKLEIREKEIEGVKAKCIPRRP 356 Query: 181 KATASKKDLG 210 K +++K+LG Sbjct: 357 KNQSTRKELG 366 >ref|XP_016548468.1| PREDICTED: protein UPSTREAM OF FLC [Capsicum annuum] Length = 459 Score = 78.6 bits (192), Expect = 2e-13 Identities = 38/70 (54%), Positives = 51/70 (72%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSLIE K E+ L+RSSS NA+R K+++ EKE+EGV+ +CIPRRP Sbjct: 365 DKEYFSGSLIETK-------KDEYPALKRSSSFNADRSAKLEIREKEIEGVKAKCIPRRP 417 Query: 181 KATASKKDLG 210 K +++K+LG Sbjct: 418 KNQSTRKELG 427 >ref|XP_010253296.1| PREDICTED: protein UPSTREAM OF FLC [Nelumbo nucifera] Length = 444 Score = 78.2 bits (191), Expect = 2e-13 Identities = 41/71 (57%), Positives = 50/71 (70%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSL+E K EF L+RSSS NA+R K+DLA+KE+EGVR +CIPR+P Sbjct: 360 DKEYFSGSLVETK-------KDEFPALKRSSSYNADRSSKLDLADKEIEGVRAKCIPRKP 412 Query: 181 KATASKKDLGD 213 K T KK+ D Sbjct: 413 K-TPGKKESND 422 >gb|PHT34427.1| Protein UPSTREAM OF FLC [Capsicum baccatum] Length = 459 Score = 77.8 bits (190), Expect = 3e-13 Identities = 38/70 (54%), Positives = 50/70 (71%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSLIE K E+ L+RSSS NA+R K ++ EKE+EGV+ +CIPRRP Sbjct: 365 DKEYFSGSLIETK-------KDEYPALKRSSSFNADRSAKFEIREKEIEGVKAKCIPRRP 417 Query: 181 KATASKKDLG 210 K +++K+LG Sbjct: 418 KNQSTRKELG 427 >ref|XP_007016521.2| PREDICTED: protein UPSTREAM OF FLC [Theobroma cacao] ref|XP_017984014.1| PREDICTED: protein UPSTREAM OF FLC [Theobroma cacao] Length = 454 Score = 77.0 bits (188), Expect = 6e-13 Identities = 41/68 (60%), Positives = 51/68 (75%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSLIE K KE E L+RSSS NA+R ++ LAEKE+EGVRT+CIPR+P Sbjct: 370 DKEYFSGSLIETK--KE-----EVPALKRSSSYNADRSSQLQLAEKEIEGVRTKCIPRKP 422 Query: 181 KATASKKD 204 K ++KK+ Sbjct: 423 KTLSTKKE 430 >gb|EOY34140.1| Domain of Uncharacterized protein function, putative [Theobroma cacao] Length = 454 Score = 77.0 bits (188), Expect = 6e-13 Identities = 41/68 (60%), Positives = 51/68 (75%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSLIE K KE E L+RSSS NA+R ++ LAEKE+EGVRT+CIPR+P Sbjct: 370 DKEYFSGSLIETK--KE-----EVPALKRSSSYNADRSSQLQLAEKEIEGVRTKCIPRKP 422 Query: 181 KATASKKD 204 K ++KK+ Sbjct: 423 KTLSTKKE 430 >ref|XP_006363367.1| PREDICTED: protein UPSTREAM OF FLC [Solanum tuberosum] Length = 457 Score = 75.9 bits (185), Expect = 2e-12 Identities = 38/70 (54%), Positives = 49/70 (70%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSLIE E+ L+RSSS NA+R K+++ EKE+EGVR +CIPRR Sbjct: 362 DKEYFSGSLIETS-------KDEYPALKRSSSFNADRSAKLEIREKEIEGVRAKCIPRRS 414 Query: 181 KATASKKDLG 210 K +S+K+LG Sbjct: 415 KNQSSRKELG 424 >ref|XP_009402338.1| PREDICTED: protein UPSTREAM OF FLC-like [Musa acuminata subsp. malaccensis] Length = 435 Score = 75.5 bits (184), Expect = 2e-12 Identities = 39/67 (58%), Positives = 49/67 (73%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSLIE K K +F GL+RSSS NA+R K++LAEKE+EGVR +CIPR+ Sbjct: 349 DKEYFSGSLIETK--KGGDGRADFPGLKRSSSYNADRCSKLELAEKEIEGVRAKCIPRKH 406 Query: 181 KATASKK 201 KA ++ Sbjct: 407 KAVERRE 413 >ref|XP_002534353.1| PREDICTED: protein UPSTREAM OF FLC [Ricinus communis] gb|EEF28033.1| conserved hypothetical protein [Ricinus communis] Length = 441 Score = 75.5 bits (184), Expect = 2e-12 Identities = 42/68 (61%), Positives = 49/68 (72%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSLIE K KE E L+RSSS NA+R + LAEKEVEG RT+CIPR+P Sbjct: 354 DKEYFSGSLIETK--KE-----EVPALKRSSSYNADRSSHLHLAEKEVEGARTKCIPRKP 406 Query: 181 KATASKKD 204 KA +KK+ Sbjct: 407 KAIPTKKE 414 >ref|XP_009403454.1| PREDICTED: protein UPSTREAM OF FLC-like [Musa acuminata subsp. malaccensis] ref|XP_018683322.1| PREDICTED: protein UPSTREAM OF FLC-like [Musa acuminata subsp. malaccensis] Length = 406 Score = 74.7 bits (182), Expect = 4e-12 Identities = 36/67 (53%), Positives = 44/67 (65%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSL+E G GE L+RSSS NA+RG KMDL ++ E RTRC+PR+P Sbjct: 339 DKEYFSGSLVETDKMVGDGEGGELPSLKRSSSDNADRGSKMDLGKQVEEDARTRCVPRKP 398 Query: 181 KATASKK 201 K +K Sbjct: 399 KTRKERK 405 >ref|XP_020087659.1| protein UPSTREAM OF FLC [Ananas comosus] ref|XP_020087660.1| protein UPSTREAM OF FLC [Ananas comosus] gb|OAY72131.1| Protein UPSTREAM OF FLC [Ananas comosus] Length = 433 Score = 74.7 bits (182), Expect = 4e-12 Identities = 37/70 (52%), Positives = 50/70 (71%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSL+E K T G + EF GL+RSSS NA+R +++L E E+E R +CIPR+P Sbjct: 353 DKEYFSGSLVETKKTVSEG-AAEFPGLKRSSSYNADRSARLELVENEIESARAKCIPRKP 411 Query: 181 KATASKKDLG 210 + S+ +LG Sbjct: 412 R-IVSRSNLG 420 >dbj|GAV57882.1| DUF966 domain-containing protein [Cephalotus follicularis] Length = 455 Score = 74.7 bits (182), Expect = 4e-12 Identities = 42/71 (59%), Positives = 55/71 (77%), Gaps = 1/71 (1%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAE-RGLKMDLAEKEVEGVRTRCIPRR 177 DKEYFSGS+IE K KE + L+RS+S NA+ R L+++LAEKE+EGVRT+CIPR+ Sbjct: 378 DKEYFSGSVIETK--KE-----DIPSLKRSNSYNADGRTLQLNLAEKEMEGVRTKCIPRK 430 Query: 178 PKATASKKDLG 210 PKA A+KK+ G Sbjct: 431 PKALAAKKESG 441 >ref|XP_016462372.1| PREDICTED: protein UPSTREAM OF FLC-like [Nicotiana tabacum] Length = 457 Score = 74.7 bits (182), Expect = 4e-12 Identities = 38/68 (55%), Positives = 48/68 (70%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSLIE K E+ L+RSSS NA+R K++L EKE++ VR RCIPRRP Sbjct: 365 DKEYFSGSLIETK-------KDEYPALKRSSSFNADRSAKLELREKEIDEVRARCIPRRP 417 Query: 181 KATASKKD 204 K ++KK+ Sbjct: 418 KNQSTKKE 425 >gb|OVA03541.1| Protein of unknown function DUF966 [Macleaya cordata] Length = 467 Score = 74.7 bits (182), Expect = 4e-12 Identities = 39/67 (58%), Positives = 46/67 (68%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSLIE K EFS L+RSSS NA+R K+ L EKE+EGVR +CIPR+P Sbjct: 368 DKEYFSGSLIETK-------KDEFSALKRSSSYNADRSSKLVLREKEIEGVRAKCIPRKP 420 Query: 181 KATASKK 201 K K+ Sbjct: 421 KTLMKKQ 427 >ref|XP_023898430.1| protein UPSTREAM OF FLC [Quercus suber] gb|POE53202.1| protein upstream of flc [Quercus suber] Length = 468 Score = 74.3 bits (181), Expect = 5e-12 Identities = 37/68 (54%), Positives = 50/68 (73%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSLIE + + E L+RSSS NA+R ++ LA++E+EGVRT+CIPR+P Sbjct: 384 DKEYFSGSLIET-----NKKDVEVPNLKRSSSYNADRSSQLQLADEEIEGVRTKCIPRKP 438 Query: 181 KATASKKD 204 K ++KKD Sbjct: 439 KTQSTKKD 446 >ref|XP_021279214.1| LOW QUALITY PROTEIN: protein UPSTREAM OF FLC [Herrania umbratica] Length = 453 Score = 73.9 bits (180), Expect = 7e-12 Identities = 40/68 (58%), Positives = 49/68 (72%) Frame = +1 Query: 1 DKEYFSGSLIEIKITKESGRSGEFSGLRRSSSCNAERGLKMDLAEKEVEGVRTRCIPRRP 180 DKEYFSGSLIE K KE E L RSSS NA+R ++ LAEKE+EGVR +CIPR+P Sbjct: 369 DKEYFSGSLIETK--KE-----EVPALTRSSSYNADRSSQLQLAEKEIEGVRAKCIPRKP 421 Query: 181 KATASKKD 204 K ++KK+ Sbjct: 422 KTLSTKKE 429