BLASTX nr result
ID: Ophiopogon22_contig00030755
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00030755 (450 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN72549.1| hypothetical protein VITISV_035351 [Vitis vinifera] 60 1e-08 ref|XP_008653655.1| uncharacterized protein LOC103633740 [Zea mays] 60 6e-08 emb|CBI17116.3| unnamed protein product, partial [Vitis vinifera] 60 1e-07 ref|XP_010651748.1| PREDICTED: syndetin [Vitis vinifera] 60 1e-07 gb|ONM52088.1| hypothetical protein ZEAMMB73_Zm00001d019071 [Zea... 60 1e-07 gb|ONM11434.1| Protease Do-like 7 [Zea mays] 59 1e-07 gb|AQK64078.1| C-terminal isoform 3 [Zea mays] 59 2e-07 ref|XP_020093845.1| syndetin isoform X2 [Ananas comosus] 59 2e-07 ref|XP_020093844.1| syndetin isoform X1 [Ananas comosus] 59 3e-07 gb|OEL23349.1| hypothetical protein BAE44_0015634 [Dichanthelium... 59 3e-07 gb|ACN36683.1| unknown [Zea mays] 59 4e-07 gb|ONL99648.1| hypothetical protein ZEAMMB73_Zm00001d029818 [Zea... 59 5e-07 ref|NP_001335607.1| uncharacterized LOC100384314 [Zea mays] >gi|... 59 5e-07 gb|ONL99650.1| hypothetical protein ZEAMMB73_Zm00001d029818 [Zea... 59 5e-07 gb|ONL99652.1| hypothetical protein ZEAMMB73_Zm00001d029818 [Zea... 59 5e-07 ref|XP_014620083.1| PREDICTED: syndetin-like isoform X3 [Glycine... 58 6e-07 ref|XP_006592295.1| PREDICTED: syndetin-like isoform X2 [Glycine... 58 6e-07 gb|OVA19468.1| Protein of unknown function DUF2451 [Macleaya cor... 58 6e-07 ref|XP_014620082.1| PREDICTED: syndetin-like isoform X1 [Glycine... 58 6e-07 gb|PNT55826.1| hypothetical protein POPTR_001G212600v3 [Populus ... 58 9e-07 >emb|CAN72549.1| hypothetical protein VITISV_035351 [Vitis vinifera] Length = 144 Score = 60.5 bits (145), Expect = 1e-08 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH RL+LPS+S EL SIYGS P+GQV+E+LEE+FYE+ Sbjct: 96 PPHQRLILPSSSEELNSIYGSRPRGQVVEELEEDFYEE 133 >ref|XP_008653655.1| uncharacterized protein LOC103633740 [Zea mays] Length = 230 Score = 60.1 bits (144), Expect = 6e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R+ LPSNS +LVSIYGS PQGQV+E+LEE FYE+ Sbjct: 101 PPHERINLPSNSEDLVSIYGSNPQGQVMEELEEVFYEE 138 >emb|CBI17116.3| unnamed protein product, partial [Vitis vinifera] Length = 1060 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH RL+LPS+S EL SIYGS P+GQV+E+LEE+FYE+ Sbjct: 50 PPHQRLILPSSSEELNSIYGSRPRGQVVEELEEDFYEE 87 >ref|XP_010651748.1| PREDICTED: syndetin [Vitis vinifera] Length = 1134 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH RL+LPS+S EL SIYGS P+GQV+E+LEE+FYE+ Sbjct: 96 PPHQRLILPSSSEELNSIYGSRPRGQVVEELEEDFYEE 133 >gb|ONM52088.1| hypothetical protein ZEAMMB73_Zm00001d019071 [Zea mays] Length = 334 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R+ LPSNS +LVSIYGS PQGQV+E+LEE FYE+ Sbjct: 233 PPHERINLPSNSEDLVSIYGSNPQGQVMEELEEVFYEE 270 >gb|ONM11434.1| Protease Do-like 7 [Zea mays] Length = 229 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R+ LPSNS +LVSIYGS PQGQ +E+LEE FYE+ Sbjct: 51 PPHERINLPSNSEDLVSIYGSNPQGQAVEELEEVFYEE 88 >gb|AQK64078.1| C-terminal isoform 3 [Zea mays] Length = 245 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R+ LPSNS +LVSIYGS PQGQ +E+LEE FYE+ Sbjct: 173 PPHERINLPSNSEDLVSIYGSNPQGQALEELEEVFYEE 210 >ref|XP_020093845.1| syndetin isoform X2 [Ananas comosus] Length = 1092 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R+ LPS+S ELVSIYGS PQ Q IE+LEE+FYE+ Sbjct: 76 PPHQRISLPSSSDELVSIYGSYPQDQTIEELEEDFYEE 113 >ref|XP_020093844.1| syndetin isoform X1 [Ananas comosus] Length = 1101 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R+ LPS+S ELVSIYGS PQ Q IE+LEE+FYE+ Sbjct: 76 PPHQRISLPSSSDELVSIYGSYPQDQTIEELEEDFYEE 113 >gb|OEL23349.1| hypothetical protein BAE44_0015634 [Dichanthelium oligosanthes] Length = 1082 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R+ LPSNS +LVSIYGS PQG+ +EDLEE FYE+ Sbjct: 103 PPHERINLPSNSEDLVSIYGSNPQGEPVEDLEEVFYEE 140 >gb|ACN36683.1| unknown [Zea mays] Length = 336 Score = 58.5 bits (140), Expect = 4e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R+ LPSNS +LVSIYGS PQGQ +E+LEE FYE+ Sbjct: 102 PPHERINLPSNSEDLVSIYGSNPQGQPVEELEEVFYEE 139 >gb|ONL99648.1| hypothetical protein ZEAMMB73_Zm00001d029818 [Zea mays] Length = 1038 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R+ LPSNS +LVSIYGS PQGQ +E+LEE FYE+ Sbjct: 53 PPHERINLPSNSEDLVSIYGSNPQGQPVEELEEVFYEE 90 >ref|NP_001335607.1| uncharacterized LOC100384314 [Zea mays] gb|ONL99656.1| hypothetical protein ZEAMMB73_Zm00001d029818 [Zea mays] Length = 1087 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R+ LPSNS +LVSIYGS PQGQ +E+LEE FYE+ Sbjct: 102 PPHERINLPSNSEDLVSIYGSNPQGQPVEELEEVFYEE 139 >gb|ONL99650.1| hypothetical protein ZEAMMB73_Zm00001d029818 [Zea mays] Length = 1097 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R+ LPSNS +LVSIYGS PQGQ +E+LEE FYE+ Sbjct: 102 PPHERINLPSNSEDLVSIYGSNPQGQPVEELEEVFYEE 139 >gb|ONL99652.1| hypothetical protein ZEAMMB73_Zm00001d029818 [Zea mays] Length = 1126 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R+ LPSNS +LVSIYGS PQGQ +E+LEE FYE+ Sbjct: 102 PPHERINLPSNSEDLVSIYGSNPQGQPVEELEEVFYEE 139 >ref|XP_014620083.1| PREDICTED: syndetin-like isoform X3 [Glycine max] Length = 1021 Score = 58.2 bits (139), Expect = 6e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R L S+S EL SIYGSIPQGQV+E+LE+EFYE+ Sbjct: 100 PPHQRYSLSSSSEELSSIYGSIPQGQVVEELEDEFYEE 137 >ref|XP_006592295.1| PREDICTED: syndetin-like isoform X2 [Glycine max] gb|KHN21093.1| Coiled-coil domain-containing protein 132 [Glycine soja] gb|KRH25136.1| hypothetical protein GLYMA_12G083200 [Glycine max] Length = 1128 Score = 58.2 bits (139), Expect = 6e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R L S+S EL SIYGSIPQGQV+E+LE+EFYE+ Sbjct: 100 PPHQRYSLSSSSEELSSIYGSIPQGQVVEELEDEFYEE 137 >gb|OVA19468.1| Protein of unknown function DUF2451 [Macleaya cordata] Length = 1140 Score = 58.2 bits (139), Expect = 6e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R LPS+S ELVSIYGS P+GQ++E+LEE+FYE+ Sbjct: 98 PPHQRHSLPSSSEELVSIYGSRPRGQIVEELEEDFYEE 135 >ref|XP_014620082.1| PREDICTED: syndetin-like isoform X1 [Glycine max] Length = 1159 Score = 58.2 bits (139), Expect = 6e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R L S+S EL SIYGSIPQGQV+E+LE+EFYE+ Sbjct: 100 PPHQRYSLSSSSEELSSIYGSIPQGQVVEELEDEFYEE 137 >gb|PNT55826.1| hypothetical protein POPTR_001G212600v3 [Populus trichocarpa] Length = 1031 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 115 PPH*RLVLPSNSGELVSIYGSIPQGQVIEDLEEEFYEQ 2 PPH R LPS+S EL SIYGSIPQG ++E+LEE+FYE+ Sbjct: 106 PPHQRFNLPSSSEELRSIYGSIPQGHMVEELEEDFYEE 143