BLASTX nr result
ID: Ophiopogon22_contig00030105
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00030105 (824 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020240775.1| pentatricopeptide repeat-containing protein ... 65 2e-08 ref|XP_008792753.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-06 >ref|XP_020240775.1| pentatricopeptide repeat-containing protein At3g29290 isoform X1 [Asparagus officinalis] ref|XP_020240776.1| pentatricopeptide repeat-containing protein At3g29290 isoform X2 [Asparagus officinalis] gb|ONK60094.1| uncharacterized protein A4U43_C08F14120 [Asparagus officinalis] Length = 534 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = -3 Query: 819 TLAKKLYTKMISIGLKQDGKTRALMLQHLPNEVARHPRARCVQR 688 TLAKK+Y KM SIGL DGKTRALMLQHLP + + PR CVQR Sbjct: 490 TLAKKIYAKMTSIGLNPDGKTRALMLQHLPEKGPKSPRKNCVQR 533 >ref|XP_008792753.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 [Phoenix dactylifera] Length = 607 Score = 59.7 bits (143), Expect = 2e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 822 ITLAKKLYTKMISIGLKQDGKTRALMLQHLPN 727 ITLAKKLYTKM SIGLK DG+TRALMLQHLPN Sbjct: 572 ITLAKKLYTKMRSIGLKPDGRTRALMLQHLPN 603