BLASTX nr result
ID: Ophiopogon22_contig00030007
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00030007 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251631.1| tRNA(adenine(34)) deaminase, chloroplastic [... 61 2e-08 >ref|XP_020251631.1| tRNA(adenine(34)) deaminase, chloroplastic [Asparagus officinalis] gb|ONK81336.1| tRNA(adenine(34)) deaminase, chloroplastic [Asparagus officinalis] Length = 1240 Score = 61.2 bits (147), Expect = 2e-08 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = -1 Query: 168 SSERDRYSEYEKVSDVRNVDRGESSTSVVKRKNEIDKWVVGQSNSRKSLLRGSNFE 1 S +R+RYSEY S NVDRGESSTS KR++EIDK VV Q++SR S LR + E Sbjct: 189 SLDRERYSEYRNESRRINVDRGESSTSFDKRQSEIDKRVVAQADSRNSSLRAGDVE 244