BLASTX nr result
ID: Ophiopogon22_contig00029639
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00029639 (630 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010908337.1| PREDICTED: CRIB domain-containing protein RI... 57 2e-06 ref|XP_008792906.1| PREDICTED: CRIB domain-containing protein RI... 55 4e-06 ref|XP_020248243.1| CRIB domain-containing protein RIC4-like [As... 55 7e-06 >ref|XP_010908337.1| PREDICTED: CRIB domain-containing protein RIC4 [Elaeis guineensis] ref|XP_010908338.1| PREDICTED: CRIB domain-containing protein RIC4 [Elaeis guineensis] Length = 165 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +1 Query: 22 TGMKSWDKGPDLLSLPTISLKQFELAMAAQTGGP 123 + MKSWDK PD LS+P++SL+QFELAM AQTG P Sbjct: 122 SSMKSWDKAPDFLSIPSLSLRQFELAMEAQTGAP 155 >ref|XP_008792906.1| PREDICTED: CRIB domain-containing protein RIC4-like [Phoenix dactylifera] Length = 163 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +1 Query: 22 TGMKSWDKGPDLLSLPTISLKQFELAMAAQTGGP 123 + MKSWDK D LS+P++SL+QFELAMAAQTG P Sbjct: 122 SSMKSWDKAQDFLSIPSLSLRQFELAMAAQTGAP 155 >ref|XP_020248243.1| CRIB domain-containing protein RIC4-like [Asparagus officinalis] gb|ONK56227.1| uncharacterized protein A4U43_C10F5430 [Asparagus officinalis] Length = 159 Score = 54.7 bits (130), Expect = 7e-06 Identities = 29/40 (72%), Positives = 32/40 (80%), Gaps = 4/40 (10%) Frame = +1 Query: 19 NTGMKSWD---KGPDLLSLPTISLKQFELAMAAQ-TGGPH 126 NT MKSW+ KGP+LLSLPTISLKQFELAMA+Q PH Sbjct: 120 NTNMKSWNNFNKGPELLSLPTISLKQFELAMASQANNSPH 159