BLASTX nr result
ID: Ophiopogon22_contig00029353
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00029353 (351 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241090.1| uncharacterized protein LOC109819684 [Aspara... 47 5e-07 >ref|XP_020241090.1| uncharacterized protein LOC109819684 [Asparagus officinalis] gb|ONK60244.1| uncharacterized protein A4U43_C08F15930 [Asparagus officinalis] Length = 735 Score = 47.0 bits (110), Expect(2) = 5e-07 Identities = 36/87 (41%), Positives = 42/87 (48%), Gaps = 1/87 (1%) Frame = -1 Query: 351 SKKGMNNISSGSGKLRAPPAELVVAGHVRDYCDDHPRHQGNGRIHPSMTESVRYRPG-VA 175 SKKG +N S + + PP E +D S ES+RYRP VA Sbjct: 639 SKKGTSNEPSRRTRTKPPPVE-----PAKDQ---------------STAESLRYRPERVA 678 Query: 174 SLP*EPMPPVVEATVSKGPVRATSLQP 94 SLP E PVVE V + PVR TSLQP Sbjct: 679 SLPPELTTPVVEGGVGRRPVRTTSLQP 705 Score = 34.3 bits (77), Expect(2) = 5e-07 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -3 Query: 91 LYPRLPDYDEFTARLIALKN 32 L+PRLPDYD+ AR IALK+ Sbjct: 715 LHPRLPDYDDLAARFIALKH 734