BLASTX nr result
ID: Ophiopogon22_contig00029332
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00029332 (998 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020249335.1| CBS domain-containing protein CBSX5-like [As... 69 1e-09 ref|XP_020689884.1| CBS domain-containing protein CBSX5-like [De... 59 4e-06 ref|XP_011098329.2| CBS domain-containing protein CBSX5 [Sesamum... 58 1e-05 >ref|XP_020249335.1| CBS domain-containing protein CBSX5-like [Asparagus officinalis] Length = 270 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -3 Query: 702 CMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNSRV 565 CMVDVLC LC+EGN+S AAALK+PVSALLAKGEG V+++E +S + Sbjct: 141 CMVDVLCFLCSEGNISNPAAALKNPVSALLAKGEGLVKRVEASSSI 186 >ref|XP_020689884.1| CBS domain-containing protein CBSX5-like [Dendrobium catenatum] gb|PKU86656.1| CBS domain-containing protein CBSX5 [Dendrobium catenatum] Length = 388 Score = 59.3 bits (142), Expect = 4e-06 Identities = 28/47 (59%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = -3 Query: 702 CMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGS-VRKLETNSRV 565 CMVD+LC LCAE N+S+ AALK+P+SALL+KG + +R++E++SRV Sbjct: 64 CMVDILCYLCAEENISSPVAALKNPISALLSKGMAALMRRVESHSRV 110 >ref|XP_011098329.2| CBS domain-containing protein CBSX5 [Sesamum indicum] Length = 394 Score = 58.2 bits (139), Expect = 1e-05 Identities = 42/110 (38%), Positives = 58/110 (52%) Frame = -3 Query: 702 CMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNSRVKLRTRSFLLNFKLE 523 CMVDV+C LC E N+SA ALKSPVS LL +G VR LE +S S L L Sbjct: 66 CMVDVICYLCREENLSAPGLALKSPVSVLLPSVKGLVRHLEPSS-------SLLEAIDLT 118 Query: 522 SETACGKVAGKENTFLNVTSRKRSLRRGNCFPRFGGQPSAHFVNGQLICW 373 + A V +++ ++ S++R L++ + P+ H NGQ CW Sbjct: 119 LQGAQNLVVPIKSSTTSI-SKRRQLQKSSA----SISPTIH--NGQEFCW 161