BLASTX nr result
ID: Ophiopogon22_contig00029318
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00029318 (491 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261582.1| selenium-binding protein 1-like [Asparagus o... 70 8e-11 ref|XP_010905138.1| PREDICTED: selenium-binding protein 1 isofor... 68 4e-10 ref|XP_019701840.1| PREDICTED: selenium-binding protein 1 isofor... 68 4e-10 ref|XP_009408341.1| PREDICTED: selenium-binding protein 1 [Musa ... 65 2e-09 gb|OAY84445.1| Selenium-binding protein 1 [Ananas comosus] 65 3e-09 ref|XP_020091394.1| selenium-binding protein 1-like [Ananas como... 65 4e-09 gb|OAY84442.1| Selenium-binding protein 1 [Ananas comosus] 65 4e-09 ref|XP_008794642.1| PREDICTED: selenium-binding protein 1 [Phoen... 64 6e-09 ref|XP_008792936.1| PREDICTED: selenium-binding protein 1-like [... 64 6e-09 ref|XP_010906171.1| PREDICTED: selenium-binding protein 1-like [... 64 8e-09 ref|XP_020686339.1| selenium-binding protein 2-like [Dendrobium ... 62 5e-08 ref|XP_020247171.1| selenium-binding protein 1-like [Asparagus o... 60 1e-07 ref|XP_020570843.1| selenium-binding protein 2-like [Phalaenopsi... 60 1e-07 ref|XP_020592176.1| selenium-binding protein 2-like [Phalaenopsi... 60 2e-07 gb|AQK98714.1| Selenium-binding protein 3 [Zea mays] 59 2e-07 gb|PKA54874.1| Selenium-binding protein 2 [Apostasia shenzhenica] 60 2e-07 gb|PAN26875.1| hypothetical protein PAHAL_E00543 [Panicum hallii] 59 3e-07 gb|ONM35169.1| Selenium-binding protein 3 [Zea mays] 58 6e-07 gb|KQL08306.1| hypothetical protein SETIT_001022mg [Setaria ital... 58 8e-07 gb|ACL52654.1| unknown [Zea mays] 58 8e-07 >ref|XP_020261582.1| selenium-binding protein 1-like [Asparagus officinalis] gb|ONK72563.1| uncharacterized protein A4U43_C04F20720 [Asparagus officinalis] Length = 474 Score = 69.7 bits (169), Expect = 8e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDI 108 P+LTGQVWVGGLLQKG SVVYVT +GKESQFDVPD+ Sbjct: 345 PVLTGQVWVGGLLQKGSSVVYVTEDGKESQFDVPDV 380 >ref|XP_010905138.1| PREDICTED: selenium-binding protein 1 isoform X2 [Elaeis guineensis] ref|XP_019701842.1| PREDICTED: selenium-binding protein 1 isoform X2 [Elaeis guineensis] ref|XP_019701843.1| PREDICTED: selenium-binding protein 1 isoform X2 [Elaeis guineensis] ref|XP_019701844.1| PREDICTED: selenium-binding protein 1 isoform X2 [Elaeis guineensis] ref|XP_019701845.1| PREDICTED: selenium-binding protein 1 isoform X2 [Elaeis guineensis] ref|XP_019701846.1| PREDICTED: selenium-binding protein 1 isoform X2 [Elaeis guineensis] Length = 494 Score = 67.8 bits (164), Expect = 4e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+L+GQVWVGGLLQKG +VVYVT +GKESQFDVP+IK Sbjct: 364 PVLSGQVWVGGLLQKGSNVVYVTEDGKESQFDVPEIK 400 >ref|XP_019701840.1| PREDICTED: selenium-binding protein 1 isoform X1 [Elaeis guineensis] ref|XP_019701841.1| PREDICTED: selenium-binding protein 1 isoform X1 [Elaeis guineensis] Length = 539 Score = 67.8 bits (164), Expect = 4e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+L+GQVWVGGLLQKG +VVYVT +GKESQFDVP+IK Sbjct: 409 PVLSGQVWVGGLLQKGSNVVYVTEDGKESQFDVPEIK 445 >ref|XP_009408341.1| PREDICTED: selenium-binding protein 1 [Musa acuminata subsp. malaccensis] Length = 486 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+L GQVWVGGLLQKG VVYV+ +GKESQFDVP+IK Sbjct: 356 PVLAGQVWVGGLLQKGSDVVYVSEDGKESQFDVPEIK 392 >gb|OAY84445.1| Selenium-binding protein 1 [Ananas comosus] Length = 276 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+LTGQVWVGGL+QKG VVYVT + KESQFDVP+IK Sbjct: 146 PVLTGQVWVGGLIQKGSDVVYVTDDEKESQFDVPEIK 182 >ref|XP_020091394.1| selenium-binding protein 1-like [Ananas comosus] Length = 498 Score = 64.7 bits (156), Expect = 4e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+LTGQVWVGGL+QKG VVYVT + KESQFDVP+IK Sbjct: 368 PVLTGQVWVGGLIQKGSDVVYVTDDEKESQFDVPEIK 404 >gb|OAY84442.1| Selenium-binding protein 1 [Ananas comosus] Length = 498 Score = 64.7 bits (156), Expect = 4e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+LTGQVWVGGL+QKG VVYVT + KESQFDVP+IK Sbjct: 368 PVLTGQVWVGGLIQKGSDVVYVTDDEKESQFDVPEIK 404 >ref|XP_008794642.1| PREDICTED: selenium-binding protein 1 [Phoenix dactylifera] ref|XP_008794643.1| PREDICTED: selenium-binding protein 1 [Phoenix dactylifera] ref|XP_008794644.1| PREDICTED: selenium-binding protein 1 [Phoenix dactylifera] ref|XP_008794645.1| PREDICTED: selenium-binding protein 1 [Phoenix dactylifera] ref|XP_008794646.1| PREDICTED: selenium-binding protein 1 [Phoenix dactylifera] Length = 494 Score = 64.3 bits (155), Expect = 6e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+L+GQVWVGGLLQKG +V YVT +GKES FDVP+IK Sbjct: 364 PVLSGQVWVGGLLQKGSNVAYVTEDGKESHFDVPEIK 400 >ref|XP_008792936.1| PREDICTED: selenium-binding protein 1-like [Phoenix dactylifera] Length = 494 Score = 64.3 bits (155), Expect = 6e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+L+GQVWVGGLLQKG VVYVT +GKE QFDVP IK Sbjct: 364 PVLSGQVWVGGLLQKGSDVVYVTEDGKELQFDVPSIK 400 >ref|XP_010906171.1| PREDICTED: selenium-binding protein 1-like [Elaeis guineensis] Length = 494 Score = 63.9 bits (154), Expect = 8e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+L+GQVWVGGLLQKG VVYVT +GKE QFDVP IK Sbjct: 364 PVLSGQVWVGGLLQKGSDVVYVTEDGKELQFDVPPIK 400 >ref|XP_020686339.1| selenium-binding protein 2-like [Dendrobium catenatum] gb|PKU76151.1| Selenium-binding protein 2 [Dendrobium catenatum] Length = 498 Score = 61.6 bits (148), Expect = 5e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+LTGQVWVGGL+QKG VYV+ +G ESQFDVP +K Sbjct: 369 PVLTGQVWVGGLIQKGSDTVYVSEDGTESQFDVPQVK 405 >ref|XP_020247171.1| selenium-binding protein 1-like [Asparagus officinalis] gb|ONK56592.1| uncharacterized protein A4U43_C10F10460 [Asparagus officinalis] Length = 474 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+LTGQVWVGGLLQKG SVVYV +GKESQ +V +IK Sbjct: 345 PLLTGQVWVGGLLQKGSSVVYVDEDGKESQINVSEIK 381 >ref|XP_020570843.1| selenium-binding protein 2-like [Phalaenopsis equestris] Length = 490 Score = 60.5 bits (145), Expect = 1e-07 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+LTGQVW+GGL+QKG + VY++ +G ESQFDVP +K Sbjct: 361 PVLTGQVWLGGLIQKGSAAVYISEDGTESQFDVPQVK 397 >ref|XP_020592176.1| selenium-binding protein 2-like [Phalaenopsis equestris] Length = 510 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+LTGQVWVGG +QKG VVY+ +G E+QFDVP+IK Sbjct: 381 PVLTGQVWVGGSIQKGSDVVYIADDGSEAQFDVPEIK 417 >gb|AQK98714.1| Selenium-binding protein 3 [Zea mays] Length = 233 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIKVSTI 123 P L GQVWVGGLL KGG VVYVT + +E Q++VP +KV+++ Sbjct: 190 PFLAGQVWVGGLLPKGGDVVYVTDDSQEEQYNVPQVKVTSL 230 >gb|PKA54874.1| Selenium-binding protein 2 [Apostasia shenzhenica] Length = 497 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+LTGQVWVGGL+QKG +VYV +G ESQFDVP ++ Sbjct: 368 PVLTGQVWVGGLIQKGSDIVYVQEDGTESQFDVPAVQ 404 >gb|PAN26875.1| hypothetical protein PAHAL_E00543 [Panicum hallii] Length = 492 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+L GQVWVGGLLQKG VVYVT +G+E Q++VP +K Sbjct: 362 PVLAGQVWVGGLLQKGSDVVYVTDDGQEEQYNVPQVK 398 >gb|ONM35169.1| Selenium-binding protein 3 [Zea mays] Length = 276 Score = 58.2 bits (139), Expect = 6e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P L GQVWVGGLLQKG VVYVT +G+E Q++VP +K Sbjct: 146 PFLAGQVWVGGLLQKGSDVVYVTDDGQEQQYNVPQVK 182 >gb|KQL08306.1| hypothetical protein SETIT_001022mg [Setaria italica] Length = 457 Score = 58.2 bits (139), Expect = 8e-07 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P+L GQVWVGGLLQKG VVY+T +G+E Q++VP +K Sbjct: 327 PVLAGQVWVGGLLQKGSDVVYLTDDGQEEQYNVPQVK 363 >gb|ACL52654.1| unknown [Zea mays] Length = 457 Score = 58.2 bits (139), Expect = 8e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +1 Query: 1 PILTGQVWVGGLLQKGGSVVYVTVNGKESQFDVPDIK 111 P L GQVWVGGLLQKG VVYVT +G+E Q++VP +K Sbjct: 327 PFLAGQVWVGGLLQKGSDVVYVTDDGQEQQYNVPQVK 363