BLASTX nr result
ID: Ophiopogon22_contig00029182
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00029182 (562 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259944.1| tetraspanin-18-like isoform X2 [Asparagus of... 67 3e-10 ref|XP_020259943.1| tetraspanin-18-like isoform X1 [Asparagus of... 67 6e-10 >ref|XP_020259944.1| tetraspanin-18-like isoform X2 [Asparagus officinalis] Length = 193 Score = 66.6 bits (161), Expect = 3e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +2 Query: 116 AGLLPDLNYLQTFVGLIVVLFSLWMLNDWNRHGIDKTSAP 235 + L LNYLQTF G V+L+SLWMLNDWNRHG+DK+SAP Sbjct: 11 SSFLKFLNYLQTFAGAFVLLYSLWMLNDWNRHGVDKSSAP 50 >ref|XP_020259943.1| tetraspanin-18-like isoform X1 [Asparagus officinalis] gb|ONK70894.1| uncharacterized protein A4U43_C04F2620 [Asparagus officinalis] Length = 234 Score = 66.6 bits (161), Expect = 6e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +2 Query: 116 AGLLPDLNYLQTFVGLIVVLFSLWMLNDWNRHGIDKTSAP 235 + L LNYLQTF G V+L+SLWMLNDWNRHG+DK+SAP Sbjct: 11 SSFLKFLNYLQTFAGAFVLLYSLWMLNDWNRHGVDKSSAP 50