BLASTX nr result
ID: Ophiopogon22_contig00028900
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00028900 (626 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_073495623.1| hypothetical protein [Enterococcus faecalis] 52 9e-06 >ref|WP_073495623.1| hypothetical protein [Enterococcus faecalis] Length = 65 Score = 52.0 bits (123), Expect = 9e-06 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 487 VVKSKRPRTHPTELAYEGKDNPPCCQRSEERRVGKECRSRWSPYH 621 V KS+ + PT +GK N C RSEERRVGKECRSRWSPYH Sbjct: 25 VDKSEGMKIIPTP---QGKTNAECL-RSEERRVGKECRSRWSPYH 65