BLASTX nr result
ID: Ophiopogon22_contig00028829
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00028829 (379 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019710200.1| PREDICTED: probable NADH dehydrogenase [ubiq... 64 3e-10 ref|XP_020267105.1| probable NADH dehydrogenase [ubiquinone] 1 a... 62 2e-09 ref|XP_008781156.1| PREDICTED: probable NADH dehydrogenase [ubiq... 62 2e-09 ref|XP_019453867.1| PREDICTED: probable NADH dehydrogenase [ubiq... 60 1e-08 ref|XP_020675251.1| probable NADH dehydrogenase [ubiquinone] 1 a... 59 2e-08 dbj|GAY45628.1| hypothetical protein CUMW_090810 [Citrus unshiu] 59 2e-08 gb|PKU75832.1| putative NADH dehydrogenase [ubiquinone] 1 alpha ... 59 4e-08 gb|PKA62398.1| putative NADH dehydrogenase [ubiquinone] 1 alpha ... 59 4e-08 ref|XP_006422059.1| probable NADH dehydrogenase [ubiquinone] 1 a... 59 5e-08 ref|XP_019449713.1| PREDICTED: probable NADH dehydrogenase [ubiq... 58 9e-08 ref|XP_020087602.1| probable NADH dehydrogenase [ubiquinone] 1 a... 57 1e-07 ref|XP_020586873.1| probable NADH dehydrogenase [ubiquinone] 1 a... 57 1e-07 ref|NP_001236867.1| uncharacterized protein LOC100526984 [Glycin... 57 2e-07 ref|XP_010921430.1| PREDICTED: probable NADH dehydrogenase [ubiq... 56 5e-07 gb|OAO98165.1| hypothetical protein AXX17_AT4G32250 [Arabidopsis... 54 7e-07 ref|XP_002513634.1| PREDICTED: probable NADH dehydrogenase [ubiq... 55 9e-07 ref|XP_010521367.1| PREDICTED: probable NADH dehydrogenase [ubiq... 55 1e-06 gb|AAU44524.1| hypothetical protein AT4G28005 [Arabidopsis thali... 54 1e-06 ref|NP_680745.1| NADH dehydrogenase ubiquinone 1 alpha subcomple... 54 1e-06 gb|AAL32032.1|AF439273_1 NADH-ubiquinone oxidoreductase, partial... 55 1e-06 >ref|XP_019710200.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Elaeis guineensis] Length = 170 Score = 64.3 bits (155), Expect = 3e-10 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVEASPESK 120 PIPKHVP HRPPPLPEEF++T EAI SKPA E S +SK Sbjct: 130 PIPKHVPQHRPPPLPEEFYKTLEAITSKPAPKDEPSTQSK 169 >ref|XP_020267105.1| probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Asparagus officinalis] gb|ONK67619.1| uncharacterized protein A4U43_C05F1960 [Asparagus officinalis] Length = 170 Score = 62.0 bits (149), Expect = 2e-09 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVEASPESKA 123 PIPKHVPFHR PPLPEEFH+T EAI SK +S +SKA Sbjct: 130 PIPKHVPFHRSPPLPEEFHKTLEAITSKSRPDEASSTDSKA 170 >ref|XP_008781156.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Phoenix dactylifera] Length = 170 Score = 62.0 bits (149), Expect = 2e-09 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVEASPESKA 123 PIPKHVP HRP PLPEEF++T EA+ SKPA E S +SKA Sbjct: 130 PIPKHVPQHRPAPLPEEFYKTLEALTSKPAPKDEPSTQSKA 170 >ref|XP_019453867.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Lupinus angustifolius] gb|OIW06379.1| hypothetical protein TanjilG_15024 [Lupinus angustifolius] Length = 165 Score = 60.1 bits (144), Expect = 1e-08 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVEASPESKA 123 P+PKHVP HRPPPLP EFH+T EAI S T +S ESKA Sbjct: 125 PVPKHVPLHRPPPLPTEFHKTLEAIQSGKDTPAVSSGESKA 165 >ref|XP_020675251.1| probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Dendrobium catenatum] Length = 167 Score = 59.3 bits (142), Expect = 2e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVEAS 108 PIPKHVP HRPPPLP+EF++T EA+ SKPA+ E+S Sbjct: 130 PIPKHVPQHRPPPLPKEFYKTLEAVQSKPASKDESS 165 >dbj|GAY45628.1| hypothetical protein CUMW_090810 [Citrus unshiu] Length = 168 Score = 59.3 bits (142), Expect = 2e-08 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVEASPESKA 123 P+PKHVP HRP PLPEEFH+T EA+ K TAV AS ES++ Sbjct: 125 PVPKHVPLHRPGPLPEEFHKTLEAVTKKDPTAV-ASSESQS 164 >gb|PKU75832.1| putative NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Dendrobium catenatum] Length = 192 Score = 59.3 bits (142), Expect = 4e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVEAS 108 PIPKHVP HRPPPLP+EF++T EA+ SKPA+ E+S Sbjct: 155 PIPKHVPQHRPPPLPKEFYKTLEAVQSKPASKDESS 190 >gb|PKA62398.1| putative NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Apostasia shenzhenica] Length = 163 Score = 58.5 bits (140), Expect = 4e-08 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPA 90 PIPKHVP HRPPPLPEEF++T EA+ SKPA Sbjct: 130 PIPKHVPHHRPPPLPEEFYKTLEAVRSKPA 159 >ref|XP_006422059.1| probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Citrus clementina] ref|XP_006490615.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Citrus sinensis] gb|ESR35299.1| hypothetical protein CICLE_v10006072mg [Citrus clementina] gb|KDO56824.1| hypothetical protein CISIN_1g030948mg [Citrus sinensis] Length = 168 Score = 58.5 bits (140), Expect = 5e-08 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVEAS 108 P+PKHVP HRP PLPEEFH+T EA+ K TAV +S Sbjct: 125 PVPKHVPLHRPGPLPEEFHKTLEAVTKKDPTAVTSS 160 >ref|XP_019449713.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Lupinus angustifolius] gb|OIW08066.1| hypothetical protein TanjilG_20167 [Lupinus angustifolius] Length = 165 Score = 57.8 bits (138), Expect = 9e-08 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVEASPESKA 123 P+PKHVP HRPPPLP EFH+T E++ S T +S ESKA Sbjct: 125 PVPKHVPLHRPPPLPTEFHKTLESLQSGKDTPAISSGESKA 165 >ref|XP_020087602.1| probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Ananas comosus] gb|OAY77352.1| putative NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 5, mitochondrial [Ananas comosus] Length = 170 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVEASPESK 120 PIPKHVP HRP PLPEEF+ T EA +KPA E++P+ K Sbjct: 130 PIPKHVPQHRPGPLPEEFYNTLEAATTKPALKDESAPQLK 169 >ref|XP_020586873.1| probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Phalaenopsis equestris] Length = 171 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVE 102 PIPKHVP HRPPPLPEEF +T EA+ SKPA E Sbjct: 130 PIPKHVPQHRPPPLPEEFFKTLEAVQSKPAAKNE 163 >ref|NP_001236867.1| uncharacterized protein LOC100526984 [Glycine max] gb|ACU16020.1| unknown [Glycine max] gb|KHN42470.1| Putative NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Glycine soja] gb|KRH38334.1| hypothetical protein GLYMA_09G129000 [Glycine max] Length = 166 Score = 56.6 bits (135), Expect = 2e-07 Identities = 27/43 (62%), Positives = 31/43 (72%), Gaps = 2/43 (4%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSK--PATAVEASPESKA 123 P+PKHVP HRPPPLP EFH+T EA+ K PA + SP SKA Sbjct: 125 PVPKHVPLHRPPPLPTEFHKTLEALTGKDTPAASSSESP-SKA 166 >ref|XP_010921430.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Elaeis guineensis] Length = 168 Score = 55.8 bits (133), Expect = 5e-07 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVEASPESKA 123 PIPKHVP HRP PLP+EF++TFEA++ K A E +SKA Sbjct: 128 PIPKHVPQHRPAPLPKEFYKTFEAVILKLAPKDEPFTQSKA 168 >gb|OAO98165.1| hypothetical protein AXX17_AT4G32250 [Arabidopsis thaliana] Length = 99 Score = 53.9 bits (128), Expect = 7e-07 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVEASPES 117 PIPKHVP HRP PLPEEF+RT +A+ S+ T + A+ S Sbjct: 55 PIPKHVPHHRPGPLPEEFYRTLQAVNSESKTEITATSSS 93 >ref|XP_002513634.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Ricinus communis] gb|EEF49037.1| NADH dehydrogenase, putative [Ricinus communis] Length = 166 Score = 55.1 bits (131), Expect = 9e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAV 99 P+PKHVP HRP PLPEEF++T EA+ SK A AV Sbjct: 125 PVPKHVPLHRPGPLPEEFYKTLEAVQSKDAPAV 157 >ref|XP_010521367.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Tarenaya hassleriana] Length = 167 Score = 55.1 bits (131), Expect = 1e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVEASPESK 120 PIPKHVP HRP PLPEEF++T EA+ S+ +SP+S+ Sbjct: 125 PIPKHVPQHRPGPLPEEFYKTLEAVASQKEIPAASSPDSQ 164 >gb|AAU44524.1| hypothetical protein AT4G28005 [Arabidopsis thaliana] Length = 112 Score = 53.9 bits (128), Expect = 1e-06 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVEASPES 117 PIPKHVP HRP PLPEEF+RT +A+ S+ T + A+ S Sbjct: 68 PIPKHVPHHRPGPLPEEFYRTLQAVNSESKTEITATSSS 106 >ref|NP_680745.1| NADH dehydrogenase ubiquinone 1 alpha subcomplex subunit [Arabidopsis thaliana] gb|AEE85419.1| NADH dehydrogenase ubiquinone 1 alpha subcomplex subunit [Arabidopsis thaliana] Length = 115 Score = 53.9 bits (128), Expect = 1e-06 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPATAVEASPES 117 PIPKHVP HRP PLPEEF+RT +A+ S+ T + A+ S Sbjct: 71 PIPKHVPHHRPGPLPEEFYRTLQAVNSESKTEITATSSS 109 >gb|AAL32032.1|AF439273_1 NADH-ubiquinone oxidoreductase, partial [Retama raetam] Length = 153 Score = 54.7 bits (130), Expect = 1e-06 Identities = 25/43 (58%), Positives = 30/43 (69%), Gaps = 2/43 (4%) Frame = +1 Query: 1 PIPKHVPFHRPPPLPEEFHRTFEAIVSKPA--TAVEASPESKA 123 P+PKHVP HRPPPLP EFH+T E + S+ T +S ESKA Sbjct: 111 PVPKHVPLHRPPPLPTEFHKTLETLQSQSGKDTPAVSSGESKA 153