BLASTX nr result
ID: Ophiopogon22_contig00028697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00028697 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK63082.1| uncharacterized protein A4U43_C07F11220 [Asparagu... 58 4e-07 >gb|ONK63082.1| uncharacterized protein A4U43_C07F11220 [Asparagus officinalis] Length = 648 Score = 58.2 bits (139), Expect = 4e-07 Identities = 36/77 (46%), Positives = 43/77 (55%), Gaps = 3/77 (3%) Frame = +3 Query: 198 IALSLSAPVQLCGGLRS---DHRRLASHHRPVTVDSNYLLPSLRYRSVCPCSSSISPRVC 368 +ALS+SA LC G+ P VDS Y++ SL SV SS ISPRVC Sbjct: 1 MALSVSAAAPLCRGVSPPLFSSPPGECFFSPAKVDSKYMVASLHCHSVLAHSSVISPRVC 60 Query: 369 GLKIWIFPQHKHLKSIR 419 GLKIWIF + K L+ IR Sbjct: 61 GLKIWIFQRLKDLQPIR 77