BLASTX nr result
ID: Ophiopogon22_contig00027965
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00027965 (657 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020691619.1| probable glucosamine 6-phosphate N-acetyltra... 63 1e-08 ref|XP_020592822.1| glucosamine 6-phosphate N-acetyltransferase ... 63 1e-08 ref|XP_020267695.1| glucosamine 6-phosphate N-acetyltransferase-... 58 6e-07 ref|XP_020089653.1| probable glucosamine 6-phosphate N-acetyltra... 58 7e-07 gb|OAY84857.1| putative glucosamine 6-phosphate N-acetyltransfer... 58 8e-07 ref|XP_009417306.1| PREDICTED: probable glucosamine 6-phosphate ... 57 8e-07 dbj|BAJ97927.1| predicted protein, partial [Hordeum vulgare subs... 57 1e-06 ref|XP_003576677.1| PREDICTED: glucosamine 6-phosphate N-acetylt... 57 1e-06 ref|XP_020177239.1| glucosamine 6-phosphate N-acetyltransferase ... 57 1e-06 ref|XP_002462565.1| glucosamine 6-phosphate N-acetyltransferase ... 57 2e-06 gb|AQK93187.1| Glucosamine 6-phosphate N-acetyltransferase [Zea ... 54 2e-06 gb|PKA50469.1| putative glucosamine 6-phosphate N-acetyltransfer... 56 3e-06 gb|EMS62889.1| hypothetical protein TRIUR3_18350 [Triticum urartu] 55 4e-06 dbj|BAH91866.1| Os02g0717700, partial [Oryza sativa Japonica Gro... 55 4e-06 ref|XP_015696615.1| PREDICTED: glucosamine 6-phosphate N-acetylt... 55 4e-06 gb|PAN13079.1| hypothetical protein PAHAL_B03324 [Panicum hallii... 55 5e-06 ref|XP_015626803.1| PREDICTED: probable glucosamine 6-phosphate ... 55 5e-06 gb|EAY87302.1| hypothetical protein OsI_08705 [Oryza sativa Indi... 55 5e-06 ref|XP_006648992.2| PREDICTED: probable glucosamine 6-phosphate ... 55 5e-06 ref|NP_001149801.1| guanine nucleotide-binding protein G(t) subu... 55 6e-06 >ref|XP_020691619.1| probable glucosamine 6-phosphate N-acetyltransferase 2 [Dendrobium catenatum] ref|XP_020691628.1| probable glucosamine 6-phosphate N-acetyltransferase 2 [Dendrobium catenatum] ref|XP_020691635.1| probable glucosamine 6-phosphate N-acetyltransferase 2 [Dendrobium catenatum] ref|XP_020691642.1| probable glucosamine 6-phosphate N-acetyltransferase 2 [Dendrobium catenatum] ref|XP_020691662.1| probable glucosamine 6-phosphate N-acetyltransferase 2 [Dendrobium catenatum] ref|XP_020691670.1| probable glucosamine 6-phosphate N-acetyltransferase 2 [Dendrobium catenatum] ref|XP_020691678.1| probable glucosamine 6-phosphate N-acetyltransferase 2 [Dendrobium catenatum] gb|PKU68536.1| putative glucosamine 6-phosphate N-acetyltransferase 2 [Dendrobium catenatum] Length = 167 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVILDCT ELRGFYEKCGFVEKNVQMA+YF Sbjct: 136 KVILDCTSELRGFYEKCGFVEKNVQMAMYF 165 >ref|XP_020592822.1| glucosamine 6-phosphate N-acetyltransferase 1 [Phalaenopsis equestris] ref|XP_020592823.1| glucosamine 6-phosphate N-acetyltransferase 1 [Phalaenopsis equestris] ref|XP_020592824.1| glucosamine 6-phosphate N-acetyltransferase 1 [Phalaenopsis equestris] ref|XP_020592825.1| glucosamine 6-phosphate N-acetyltransferase 1 [Phalaenopsis equestris] ref|XP_020592826.1| glucosamine 6-phosphate N-acetyltransferase 1 [Phalaenopsis equestris] ref|XP_020592827.1| glucosamine 6-phosphate N-acetyltransferase 1 [Phalaenopsis equestris] Length = 171 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVILDCT ELRGFYEKCGFVEKNVQMA+YF Sbjct: 140 KVILDCTSELRGFYEKCGFVEKNVQMAMYF 169 >ref|XP_020267695.1| glucosamine 6-phosphate N-acetyltransferase-like [Asparagus officinalis] gb|ONK68497.1| uncharacterized protein A4U43_C05F12340 [Asparagus officinalis] Length = 158 Score = 57.8 bits (138), Expect = 6e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVILDC + RGFYEKCGFVEKNVQMAIYF Sbjct: 129 KVILDCEPDRRGFYEKCGFVEKNVQMAIYF 158 >ref|XP_020089653.1| probable glucosamine 6-phosphate N-acetyltransferase 2 [Ananas comosus] ref|XP_020089654.1| probable glucosamine 6-phosphate N-acetyltransferase 2 [Ananas comosus] ref|XP_020089655.1| probable glucosamine 6-phosphate N-acetyltransferase 2 [Ananas comosus] ref|XP_020089656.1| probable glucosamine 6-phosphate N-acetyltransferase 2 [Ananas comosus] Length = 172 Score = 57.8 bits (138), Expect = 7e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVILDCT EL+GFYEKCGF E+N+QMA+YF Sbjct: 143 KVILDCTPELKGFYEKCGFEERNIQMALYF 172 >gb|OAY84857.1| putative glucosamine 6-phosphate N-acetyltransferase 2 [Ananas comosus] Length = 174 Score = 57.8 bits (138), Expect = 8e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVILDCT EL+GFYEKCGF E+N+QMA+YF Sbjct: 145 KVILDCTPELKGFYEKCGFEERNIQMALYF 174 >ref|XP_009417306.1| PREDICTED: probable glucosamine 6-phosphate N-acetyltransferase 2 [Musa acuminata subsp. malaccensis] ref|XP_009417307.1| PREDICTED: probable glucosamine 6-phosphate N-acetyltransferase 2 [Musa acuminata subsp. malaccensis] Length = 156 Score = 57.4 bits (137), Expect = 8e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVILDCT +LR FYEKCGF EKN+QMA+YF Sbjct: 127 KVILDCTPDLRSFYEKCGFTEKNIQMALYF 156 >dbj|BAJ97927.1| predicted protein, partial [Hordeum vulgare subsp. vulgare] Length = 154 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVIL+CT ELRGFY KCGFVEKNVQM +YF Sbjct: 125 KVILNCTPELRGFYAKCGFVEKNVQMGLYF 154 >ref|XP_003576677.1| PREDICTED: glucosamine 6-phosphate N-acetyltransferase 1 [Brachypodium distachyon] ref|XP_014757672.1| PREDICTED: glucosamine 6-phosphate N-acetyltransferase 1 [Brachypodium distachyon] gb|KQJ90746.1| hypothetical protein BRADI_4g33690v3 [Brachypodium distachyon] Length = 155 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVIL+CT ELRGFY KCGFVEKNVQM +YF Sbjct: 126 KVILNCTPELRGFYAKCGFVEKNVQMGLYF 155 >ref|XP_020177239.1| glucosamine 6-phosphate N-acetyltransferase 1-like [Aegilops tauschii subsp. tauschii] Length = 157 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVIL+CT ELRGFY KCGFVEKNVQM +YF Sbjct: 128 KVILNCTPELRGFYAKCGFVEKNVQMGLYF 157 >ref|XP_002462565.1| glucosamine 6-phosphate N-acetyltransferase 1 [Sorghum bicolor] gb|EER99086.1| hypothetical protein SORBI_3002G246800 [Sorghum bicolor] gb|OQU89688.1| hypothetical protein SORBI_3002G246800 [Sorghum bicolor] Length = 170 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVIL+CT EL+GFY KCGFVEKNVQM +YF Sbjct: 141 KVILNCTTELKGFYAKCGFVEKNVQMGLYF 170 >gb|AQK93187.1| Glucosamine 6-phosphate N-acetyltransferase [Zea mays] Length = 63 Score = 53.9 bits (128), Expect = 2e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVILDCT ELR +Y KCGFV+K VQMA+YF Sbjct: 34 KVILDCTPELRAYYAKCGFVDKGVQMAVYF 63 >gb|PKA50469.1| putative glucosamine 6-phosphate N-acetyltransferase 2 [Apostasia shenzhenica] Length = 160 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVILDC + RGFYEKCGFVEK VQMA+YF Sbjct: 129 KVILDCAADRRGFYEKCGFVEKGVQMALYF 158 >gb|EMS62889.1| hypothetical protein TRIUR3_18350 [Triticum urartu] Length = 135 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVILDCT ELR +Y KCGFVEK VQMA+YF Sbjct: 106 KVILDCTPELRAYYAKCGFVEKGVQMAVYF 135 >dbj|BAH91866.1| Os02g0717700, partial [Oryza sativa Japonica Group] dbj|BAS80624.1| Os02g0717700, partial [Oryza sativa Japonica Group] Length = 157 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVILDCT ELR +Y KCGFVEK VQMAIYF Sbjct: 128 KVILDCTPELRAYYAKCGFVEKGVQMAIYF 157 >ref|XP_015696615.1| PREDICTED: glucosamine 6-phosphate N-acetyltransferase 1 [Oryza brachyantha] Length = 162 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVIL+CT EL GFY KCGFVEKNVQM +YF Sbjct: 133 KVILNCTTELTGFYAKCGFVEKNVQMGLYF 162 >gb|PAN13079.1| hypothetical protein PAHAL_B03324 [Panicum hallii] gb|PAN13080.1| hypothetical protein PAHAL_B03324 [Panicum hallii] Length = 166 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVIL+CT ELRGFY KCGF EKNVQM +YF Sbjct: 137 KVILNCTTELRGFYAKCGFEEKNVQMGLYF 166 >ref|XP_015626803.1| PREDICTED: probable glucosamine 6-phosphate N-acetyltransferase 2 [Oryza sativa Japonica Group] sp|C7IZ16.2|GNA2_ORYSJ RecName: Full=Probable glucosamine 6-phosphate N-acetyltransferase 2; AltName: Full=Glucose-6-phosphate acetyltransferase 2; AltName: Full=Phosphoglucosamine acetylase 2; AltName: Full=Phosphoglucosamine transacetylase 2 gb|EAZ24401.1| hypothetical protein OsJ_08156 [Oryza sativa Japonica Group] Length = 166 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVILDCT ELR +Y KCGFVEK VQMAIYF Sbjct: 137 KVILDCTPELRAYYAKCGFVEKGVQMAIYF 166 >gb|EAY87302.1| hypothetical protein OsI_08705 [Oryza sativa Indica Group] Length = 170 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVILDCT ELR +Y KCGFVEK VQMAIYF Sbjct: 141 KVILDCTPELRAYYAKCGFVEKGVQMAIYF 170 >ref|XP_006648992.2| PREDICTED: probable glucosamine 6-phosphate N-acetyltransferase 2 [Oryza brachyantha] Length = 171 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVILDCT ELR +Y KCGFVEK VQMAIYF Sbjct: 142 KVILDCTPELRAYYAKCGFVEKGVQMAIYF 171 >ref|NP_001149801.1| guanine nucleotide-binding protein G(t) subunit alpha-3 [Zea mays] gb|ACG36849.1| glucosamine 6-phosphate N-acetyltransferase [Zea mays] gb|ACN25975.1| unknown [Zea mays] gb|AIB05128.1| GNAT transcription factor, partial [Zea mays] gb|AQK54821.1| Glucosamine 6-phosphate N-acetyltransferase [Zea mays] Length = 163 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 3 KVILDCTLELRGFYEKCGFVEKNVQMAIYF 92 KVILDCT ELR +Y KCGFVEK VQMA+YF Sbjct: 134 KVILDCTPELRAYYAKCGFVEKGVQMAVYF 163