BLASTX nr result
ID: Ophiopogon22_contig00027816
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00027816 (455 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU48266.1| hypothetical protein TSUD_405120 [Trifolium subt... 76 4e-15 ref|XP_013670144.1| GTP-binding protein SAR1B-like [Brassica nap... 76 4e-15 gb|KDO81697.1| hypothetical protein CISIN_1g033893mg [Citrus sin... 76 6e-15 gb|KYP32821.1| GTP-binding protein SAR1B [Cajanus cajan] 75 6e-15 emb|CBI22905.3| unnamed protein product, partial [Vitis vinifera] 76 7e-15 ref|XP_020208105.1| GTP-binding protein SAR1B-like [Cajanus cajan] 75 7e-15 ref|XP_010531789.2| PREDICTED: GTP-binding protein SAR1B-like [T... 76 2e-14 ref|XP_006644142.1| PREDICTED: GTP-binding protein SAR1A-like [O... 76 2e-14 gb|KDO87023.1| hypothetical protein CISIN_1g0294372mg, partial [... 74 3e-14 ref|XP_010910670.1| PREDICTED: GTP-binding protein SAR1A-like [E... 74 3e-14 gb|PIM99535.1| hypothetical protein CDL12_27972 [Handroanthus im... 74 3e-14 gb|OIW18405.1| hypothetical protein TanjilG_31545 [Lupinus angus... 74 3e-14 gb|KJB45410.1| hypothetical protein B456_007G304600 [Gossypium r... 76 3e-14 ref|XP_020693385.1| GTP-binding protein SAR1, partial [Dendrobiu... 74 3e-14 gb|PIN20408.1| Vesicle coat complex COPII, GTPase subunit SAR1 [... 76 3e-14 ref|XP_022946418.1| GTP-binding protein SAR1A-like isoform X2 [C... 76 4e-14 ref|XP_010549542.1| PREDICTED: GTP-binding protein SAR1B-like [T... 76 4e-14 ref|XP_022887889.1| GTP-binding protein SAR1A-like isoform X2 [O... 74 4e-14 ref|XP_013641026.1| LOW QUALITY PROTEIN: GTP-binding protein SAR... 76 4e-14 emb|CDY65544.1| BnaAnng20600D [Brassica napus] 76 4e-14 >dbj|GAU48266.1| hypothetical protein TSUD_405120 [Trifolium subterraneum] Length = 90 Score = 75.9 bits (185), Expect = 4e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 QH TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 52 QHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >ref|XP_013670144.1| GTP-binding protein SAR1B-like [Brassica napus] ref|XP_022550724.1| GTP-binding protein SAR1B-like [Brassica napus] Length = 92 Score = 75.9 bits (185), Expect = 4e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 QH TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 52 QHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >gb|KDO81697.1| hypothetical protein CISIN_1g033893mg [Citrus sinensis] Length = 109 Score = 75.9 bits (185), Expect = 6e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 QH TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 52 QHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >gb|KYP32821.1| GTP-binding protein SAR1B [Cajanus cajan] Length = 99 Score = 75.5 bits (184), Expect = 6e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 QH TSEELSIGKIKFKAFDLGGHQ+ARRVWKDYYAK Sbjct: 52 QHPTSEELSIGKIKFKAFDLGGHQVARRVWKDYYAK 87 >emb|CBI22905.3| unnamed protein product, partial [Vitis vinifera] Length = 114 Score = 75.9 bits (185), Expect = 7e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 QH TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 52 QHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >ref|XP_020208105.1| GTP-binding protein SAR1B-like [Cajanus cajan] Length = 103 Score = 75.5 bits (184), Expect = 7e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 QH TSEELSIGKIKFKAFDLGGHQ+ARRVWKDYYAK Sbjct: 52 QHPTSEELSIGKIKFKAFDLGGHQVARRVWKDYYAK 87 >ref|XP_010531789.2| PREDICTED: GTP-binding protein SAR1B-like [Tarenaya hassleriana] Length = 155 Score = 75.9 bits (185), Expect = 2e-14 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 QH TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 14 QHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 49 >ref|XP_006644142.1| PREDICTED: GTP-binding protein SAR1A-like [Oryza brachyantha] Length = 155 Score = 75.9 bits (185), Expect = 2e-14 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 QH TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 14 QHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 49 >gb|KDO87023.1| hypothetical protein CISIN_1g0294372mg, partial [Citrus sinensis] Length = 87 Score = 73.6 bits (179), Expect = 3e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 Q+ TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 52 QYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >ref|XP_010910670.1| PREDICTED: GTP-binding protein SAR1A-like [Elaeis guineensis] Length = 88 Score = 73.6 bits (179), Expect = 3e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 Q+ TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 52 QYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >gb|PIM99535.1| hypothetical protein CDL12_27972 [Handroanthus impetiginosus] Length = 90 Score = 73.6 bits (179), Expect = 3e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 Q+ TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 52 QYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >gb|OIW18405.1| hypothetical protein TanjilG_31545 [Lupinus angustifolius] Length = 119 Score = 74.3 bits (181), Expect = 3e-14 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 QH TSEELSIGKIKFKAFDLGGHQ+ARRVW+DYYAK Sbjct: 52 QHPTSEELSIGKIKFKAFDLGGHQVARRVWRDYYAK 87 >gb|KJB45410.1| hypothetical protein B456_007G304600 [Gossypium raimondii] Length = 180 Score = 75.9 bits (185), Expect = 3e-14 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 QH TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 52 QHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >ref|XP_020693385.1| GTP-binding protein SAR1, partial [Dendrobium catenatum] Length = 94 Score = 73.6 bits (179), Expect = 3e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 Q+ TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 52 QYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >gb|PIN20408.1| Vesicle coat complex COPII, GTPase subunit SAR1 [Handroanthus impetiginosus] Length = 181 Score = 75.9 bits (185), Expect = 3e-14 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 QH TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 52 QHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >ref|XP_022946418.1| GTP-binding protein SAR1A-like isoform X2 [Cucurbita moschata] Length = 186 Score = 75.9 bits (185), Expect = 4e-14 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 QH TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 45 QHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 80 >ref|XP_010549542.1| PREDICTED: GTP-binding protein SAR1B-like [Tarenaya hassleriana] Length = 187 Score = 75.9 bits (185), Expect = 4e-14 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 QH TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 52 QHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >ref|XP_022887889.1| GTP-binding protein SAR1A-like isoform X2 [Olea europaea var. sylvestris] Length = 100 Score = 73.6 bits (179), Expect = 4e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 Q+ TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 52 QYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >ref|XP_013641026.1| LOW QUALITY PROTEIN: GTP-binding protein SAR1B [Brassica napus] Length = 191 Score = 75.9 bits (185), Expect = 4e-14 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 QH TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 52 QHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >emb|CDY65544.1| BnaAnng20600D [Brassica napus] Length = 191 Score = 75.9 bits (185), Expect = 4e-14 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 346 QHRTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 453 QH TSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 52 QHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87