BLASTX nr result
ID: Ophiopogon22_contig00027794
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00027794 (448 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257647.1| uncharacterized protein LOC109834137 [Aspara... 45 5e-06 >ref|XP_020257647.1| uncharacterized protein LOC109834137 [Asparagus officinalis] gb|ONK75829.1| uncharacterized protein A4U43_C03F21000 [Asparagus officinalis] Length = 372 Score = 45.1 bits (105), Expect(2) = 5e-06 Identities = 25/48 (52%), Positives = 31/48 (64%), Gaps = 10/48 (20%) Frame = +3 Query: 9 KVQNDCSINTQRRAALLPAESKENA----------HHPIYVTGIPAWT 122 +VQN+ SI+ QRRAALLPAESKEN +PIY+TG +T Sbjct: 273 QVQNESSISRQRRAALLPAESKENTLALLGDCEDEEYPIYMTGPTLYT 320 Score = 32.7 bits (73), Expect(2) = 5e-06 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +1 Query: 205 LYTLCTALIDLDVSRQPFVVMQGQMQRPEQMFWLERIKS 321 LYTLCT LIDLD + ++QGQ ++ F++ I S Sbjct: 318 LYTLCTVLIDLD--DRTLTIIQGQPKKRRHSFFIFNILS 354