BLASTX nr result
ID: Ophiopogon22_contig00027782
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00027782 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244375.1| uncharacterized protein LOC109822571 isoform... 67 2e-12 >ref|XP_020244375.1| uncharacterized protein LOC109822571 isoform X1 [Asparagus officinalis] ref|XP_020244376.1| uncharacterized protein LOC109822571 isoform X2 [Asparagus officinalis] gb|ONK61464.1| uncharacterized protein A4U43_C08F30190 [Asparagus officinalis] Length = 309 Score = 66.6 bits (161), Expect(2) = 2e-12 Identities = 30/43 (69%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -3 Query: 410 RNGRKRNGTQYDSRFPKSRQM-NSYRENRNNWNDCTERNMGDY 285 +N RKRNG YDSRF KSRQM N+Y+ NRNNW+D TERN+G+Y Sbjct: 222 KNSRKRNGGDYDSRFSKSRQMDNNYKGNRNNWSDYTERNIGNY 264 Score = 32.7 bits (73), Expect(2) = 2e-12 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 258 GPVNHQRSAESGRACFWEKPVN 193 G NHQRS ESG +C W+K V+ Sbjct: 288 GQSNHQRSGESGSSCQWKKSVS 309