BLASTX nr result
ID: Ophiopogon22_contig00027770
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00027770 (1099 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020243637.1| RNA-directed DNA methylation 4 [Asparagus of... 62 7e-07 gb|ONK61804.1| uncharacterized protein A4U43_C08F33750 [Asparagu... 59 9e-06 >ref|XP_020243637.1| RNA-directed DNA methylation 4 [Asparagus officinalis] Length = 585 Score = 62.4 bits (150), Expect = 7e-07 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +3 Query: 969 SMKYQGCIYTS*DLVRNARFEQIWKSRKEKMKAGDDSLNEICH 1097 SM +Q CI DLVR+ARFEQIWKSR+E+MK G+DSL+EICH Sbjct: 367 SMLFQVCICPQ-DLVRSARFEQIWKSRRERMKNGEDSLHEICH 408 >gb|ONK61804.1| uncharacterized protein A4U43_C08F33750 [Asparagus officinalis] Length = 390 Score = 58.5 bits (140), Expect = 9e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 1005 DLVRNARFEQIWKSRKEKMKAGDDSLNEICH 1097 DLVR+ARFEQIWKSR+E+MK G+DSL+EICH Sbjct: 183 DLVRSARFEQIWKSRRERMKNGEDSLHEICH 213