BLASTX nr result
ID: Ophiopogon22_contig00027764
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00027764 (442 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252021.1| geranylgeranyl transferase type-2 subunit be... 72 7e-12 ref|XP_020252020.1| geranylgeranyl transferase type-2 subunit be... 70 2e-11 ref|XP_018809616.1| PREDICTED: geranylgeranyl transferase type-2... 63 8e-10 gb|KJB31782.1| hypothetical protein B456_005G208400 [Gossypium r... 63 2e-09 gb|KJB31784.1| hypothetical protein B456_005G208400 [Gossypium r... 62 7e-09 ref|XP_020252023.1| geranylgeranyl transferase type-2 subunit be... 63 7e-09 ref|XP_015868364.1| PREDICTED: geranylgeranyl transferase type-2... 62 1e-08 ref|XP_010035627.1| PREDICTED: geranylgeranyl transferase type-2... 62 1e-08 gb|OMP12003.1| Prenyltransferase/squalene oxidase [Corchorus oli... 62 2e-08 gb|KOM30975.1| hypothetical protein LR48_Vigan01g053000 [Vigna a... 62 2e-08 gb|OMO86750.1| Prenyltransferase/squalene oxidase [Corchorus oli... 62 2e-08 ref|XP_021296574.1| geranylgeranyl transferase type-2 subunit be... 62 2e-08 gb|OMO62803.1| Prenyltransferase/squalene oxidase, partial [Corc... 62 2e-08 gb|ONK76188.1| uncharacterized protein A4U43_C03F24870 [Asparagu... 62 3e-08 ref|XP_021296573.1| geranylgeranyl transferase type-2 subunit be... 62 3e-08 gb|OMO84779.1| Prenyltransferase/squalene oxidase [Corchorus cap... 62 3e-08 dbj|GAV64372.1| Prenyltrans domain-containing protein/Prenyltran... 62 3e-08 ref|XP_007010502.2| PREDICTED: geranylgeranyl transferase type-2... 62 3e-08 gb|EOY19312.1| RAB geranylgeranyl transferase beta subunit 1 [Th... 62 3e-08 gb|OVA11640.1| Prenyltransferase/squalene oxidase [Macleaya cord... 62 3e-08 >ref|XP_020252021.1| geranylgeranyl transferase type-2 subunit beta 1-like isoform X2 [Asparagus officinalis] Length = 323 Score = 71.6 bits (174), Expect = 7e-12 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQSMFFHGQLNS 108 VNYIVSCKNLDGGFGCTPGGESHAGQSM F G+ +S Sbjct: 155 VNYIVSCKNLDGGFGCTPGGESHAGQSMLFRGEQDS 190 >ref|XP_020252020.1| geranylgeranyl transferase type-2 subunit beta 1-like isoform X1 [Asparagus officinalis] Length = 328 Score = 70.5 bits (171), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQSMFFHGQ 99 VNYIVSCKNLDGGFGCTPGGESHAGQSM F G+ Sbjct: 155 VNYIVSCKNLDGGFGCTPGGESHAGQSMLFRGE 187 >ref|XP_018809616.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta 2-like, partial [Juglans regia] Length = 137 Score = 63.2 bits (152), Expect = 8e-10 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQSM 84 V+YIVSCKNLDGGFGCTPGGESHAGQSM Sbjct: 107 VSYIVSCKNLDGGFGCTPGGESHAGQSM 134 >gb|KJB31782.1| hypothetical protein B456_005G208400 [Gossypium raimondii] Length = 197 Score = 63.2 bits (152), Expect = 2e-09 Identities = 30/40 (75%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQSMF-FHGQLNSYNI 117 V+YI+SCKNLDGGFGCTPGGESHAGQS+F G SY I Sbjct: 154 VSYILSCKNLDGGFGCTPGGESHAGQSIFLLCGSSCSYGI 193 >gb|KJB31784.1| hypothetical protein B456_005G208400 [Gossypium raimondii] Length = 197 Score = 62.0 bits (149), Expect = 7e-09 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQSM 84 V+YI+SCKNLDGGFGCTPGGESHAGQSM Sbjct: 154 VSYILSCKNLDGGFGCTPGGESHAGQSM 181 >ref|XP_020252023.1| geranylgeranyl transferase type-2 subunit beta 1-like isoform X4 [Asparagus officinalis] Length = 314 Score = 63.2 bits (152), Expect = 7e-09 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQS 81 VNYIVSCKNLDGGFGCTPGGESHAGQS Sbjct: 155 VNYIVSCKNLDGGFGCTPGGESHAGQS 181 >ref|XP_015868364.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta-like [Ziziphus jujuba] Length = 238 Score = 62.0 bits (149), Expect = 1e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQSMFF 90 V+YIVSCKNLDGGFGC PGGESHAGQSM + Sbjct: 160 VSYIVSCKNLDGGFGCMPGGESHAGQSMIY 189 >ref|XP_010035627.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta 1 isoform X2 [Eucalyptus grandis] Length = 305 Score = 62.4 bits (150), Expect = 1e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQSMFFH 93 V YIVSCKN+DGGFGCTPGGESHAGQS H Sbjct: 154 VKYIVSCKNMDGGFGCTPGGESHAGQSSLHH 184 >gb|OMP12003.1| Prenyltransferase/squalene oxidase [Corchorus olitorius] Length = 275 Score = 61.6 bits (148), Expect = 2e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQ 78 VNYIVSCKNLDGGFGCTPGGESHAGQ Sbjct: 116 VNYIVSCKNLDGGFGCTPGGESHAGQ 141 >gb|KOM30975.1| hypothetical protein LR48_Vigan01g053000 [Vigna angularis] Length = 367 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQSMFFHGQLN 105 V YI+SCKN+DGGFGCTPGGESHAGQ++ G L+ Sbjct: 214 VKYIISCKNMDGGFGCTPGGESHAGQTLAITGSLD 248 >gb|OMO86750.1| Prenyltransferase/squalene oxidase [Corchorus olitorius] Length = 289 Score = 61.6 bits (148), Expect = 2e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQ 78 VNYIVSCKNLDGGFGCTPGGESHAGQ Sbjct: 130 VNYIVSCKNLDGGFGCTPGGESHAGQ 155 >ref|XP_021296574.1| geranylgeranyl transferase type-2 subunit beta 1 isoform X2 [Herrania umbratica] Length = 291 Score = 61.6 bits (148), Expect = 2e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQ 78 VNYIVSCKNLDGGFGCTPGGESHAGQ Sbjct: 154 VNYIVSCKNLDGGFGCTPGGESHAGQ 179 >gb|OMO62803.1| Prenyltransferase/squalene oxidase, partial [Corchorus capsularis] Length = 305 Score = 61.6 bits (148), Expect = 2e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQ 78 VNYIVSCKNLDGGFGCTPGGESHAGQ Sbjct: 154 VNYIVSCKNLDGGFGCTPGGESHAGQ 179 >gb|ONK76188.1| uncharacterized protein A4U43_C03F24870 [Asparagus officinalis] Length = 309 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQ 78 VNYIVSCKNLDGGFGCTPGGESHAGQ Sbjct: 155 VNYIVSCKNLDGGFGCTPGGESHAGQ 180 >ref|XP_021296573.1| geranylgeranyl transferase type-2 subunit beta 1 isoform X1 [Herrania umbratica] Length = 313 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQ 78 VNYIVSCKNLDGGFGCTPGGESHAGQ Sbjct: 154 VNYIVSCKNLDGGFGCTPGGESHAGQ 179 >gb|OMO84779.1| Prenyltransferase/squalene oxidase [Corchorus capsularis] Length = 313 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQ 78 VNYIVSCKNLDGGFGCTPGGESHAGQ Sbjct: 154 VNYIVSCKNLDGGFGCTPGGESHAGQ 179 >dbj|GAV64372.1| Prenyltrans domain-containing protein/Prenyltrans_2 domain-containing protein [Cephalotus follicularis] Length = 313 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQ 78 VNYIVSCKNLDGGFGCTPGGESHAGQ Sbjct: 154 VNYIVSCKNLDGGFGCTPGGESHAGQ 179 >ref|XP_007010502.2| PREDICTED: geranylgeranyl transferase type-2 subunit beta 1 [Theobroma cacao] Length = 315 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQ 78 VNYIVSCKNLDGGFGCTPGGESHAGQ Sbjct: 154 VNYIVSCKNLDGGFGCTPGGESHAGQ 179 >gb|EOY19312.1| RAB geranylgeranyl transferase beta subunit 1 [Theobroma cacao] Length = 315 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQ 78 VNYIVSCKNLDGGFGCTPGGESHAGQ Sbjct: 154 VNYIVSCKNLDGGFGCTPGGESHAGQ 179 >gb|OVA11640.1| Prenyltransferase/squalene oxidase [Macleaya cordata] Length = 317 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 VNYIVSCKNLDGGFGCTPGGESHAGQ 78 VNYIVSCKNLDGGFGCTPGGESHAGQ Sbjct: 154 VNYIVSCKNLDGGFGCTPGGESHAGQ 179