BLASTX nr result
ID: Ophiopogon22_contig00027721
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00027721 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010906920.1| PREDICTED: F-box/LRR-repeat protein At3g4888... 57 3e-07 ref|XP_020594066.1| F-box/LRR-repeat protein At3g48880-like [Pha... 56 1e-06 ref|XP_020682615.1| F-box/LRR-repeat protein At3g48880-like [Den... 55 2e-06 gb|PIA50874.1| hypothetical protein AQUCO_01200272v1 [Aquilegia ... 55 2e-06 gb|ERN00608.1| hypothetical protein AMTR_s00091p00086400 [Ambore... 53 2e-06 gb|PRQ38499.1| putative F-box domain-containing protein [Rosa ch... 53 3e-06 ref|XP_020518856.1| F-box protein FBW2-like [Amborella trichopoda] 54 4e-06 ref|XP_008797416.1| PREDICTED: F-box/LRR-repeat protein At3g4888... 54 5e-06 ref|XP_008793533.1| PREDICTED: F-box/LRR-repeat protein At3g4888... 53 8e-06 >ref|XP_010906920.1| PREDICTED: F-box/LRR-repeat protein At3g48880 [Elaeis guineensis] Length = 190 Score = 56.6 bits (135), Expect = 3e-07 Identities = 23/44 (52%), Positives = 31/44 (70%) Frame = +1 Query: 70 LPKDLLLRIFSKLGIEEILVGAPLACRAWYAASLDPSLYKDIDI 201 LP D L+ IF +LG+E+I G P C++WY A LDPS +K ID+ Sbjct: 46 LPLDCLVNIFKRLGVEDITTGVPFVCKSWYEAHLDPSCWKIIDL 89 >ref|XP_020594066.1| F-box/LRR-repeat protein At3g48880-like [Phalaenopsis equestris] Length = 310 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/43 (51%), Positives = 31/43 (72%) Frame = +1 Query: 79 DLLLRIFSKLGIEEILVGAPLACRAWYAASLDPSLYKDIDIED 207 D L+ IFSKLG+E++ G PL C++W+ ASLDP +K +D D Sbjct: 43 DCLVSIFSKLGLEDLTTGVPLVCKSWHVASLDPQCWKTLDFHD 85 >ref|XP_020682615.1| F-box/LRR-repeat protein At3g48880-like [Dendrobium catenatum] gb|PKU83852.1| F-box/LRR-repeat protein [Dendrobium catenatum] Length = 279 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/43 (51%), Positives = 32/43 (74%) Frame = +1 Query: 79 DLLLRIFSKLGIEEILVGAPLACRAWYAASLDPSLYKDIDIED 207 D L+ IFSKLG+E++ +G PL C+ W+ ASLDP +K +D +D Sbjct: 12 DCLVCIFSKLGLEDLSIGVPLVCKTWHRASLDPECWKILDFQD 54 >gb|PIA50874.1| hypothetical protein AQUCO_01200272v1 [Aquilegia coerulea] Length = 202 Score = 54.7 bits (130), Expect = 2e-06 Identities = 22/48 (45%), Positives = 34/48 (70%) Frame = +1 Query: 58 CTLSLPKDLLLRIFSKLGIEEILVGAPLACRAWYAASLDPSLYKDIDI 201 C L D+LL I+ KL I+++L GAPL C +WY S +PSL++++D+ Sbjct: 13 CWEDLDSDVLLIIYQKLSIKDLLFGAPLCCSSWYTISKEPSLWREVDL 60 >gb|ERN00608.1| hypothetical protein AMTR_s00091p00086400 [Amborella trichopoda] Length = 120 Score = 53.1 bits (126), Expect = 2e-06 Identities = 23/48 (47%), Positives = 30/48 (62%) Frame = +1 Query: 67 SLPKDLLLRIFSKLGIEEILVGAPLACRAWYAASLDPSLYKDIDIEDW 210 SLP+++L+ I KL E L APL C WY AS DP +K +D +DW Sbjct: 16 SLPREILVEILQKLQWNERLFTAPLVCHCWYDASRDPLCWKHLDFQDW 63 >gb|PRQ38499.1| putative F-box domain-containing protein [Rosa chinensis] Length = 131 Score = 53.1 bits (126), Expect = 3e-06 Identities = 21/47 (44%), Positives = 34/47 (72%) Frame = +1 Query: 67 SLPKDLLLRIFSKLGIEEILVGAPLACRAWYAASLDPSLYKDIDIED 207 +L KD L +F ++G++ +L+ P CR+W+AA+LDPS ++ IDI D Sbjct: 8 NLNKDCLENVFGRVGMKSLLLDVPFVCRSWHAATLDPSCWQSIDIPD 54 >ref|XP_020518856.1| F-box protein FBW2-like [Amborella trichopoda] Length = 254 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/48 (47%), Positives = 32/48 (66%) Frame = +1 Query: 67 SLPKDLLLRIFSKLGIEEILVGAPLACRAWYAASLDPSLYKDIDIEDW 210 SL +D+L+ IF KL + L G PL CR+WY AS DP +K +D++ W Sbjct: 14 SLERDILVSIFQKLDENDRLSGVPLVCRSWYHASTDPFCWKHLDLQRW 61 >ref|XP_008797416.1| PREDICTED: F-box/LRR-repeat protein At3g48880-like [Phoenix dactylifera] ref|XP_008797417.1| PREDICTED: F-box/LRR-repeat protein At3g48880-like [Phoenix dactylifera] Length = 300 Score = 54.3 bits (129), Expect = 5e-06 Identities = 19/47 (40%), Positives = 32/47 (68%) Frame = +1 Query: 70 LPKDLLLRIFSKLGIEEILVGAPLACRAWYAASLDPSLYKDIDIEDW 210 L +DLL+ IF ++G+ +++ G P C +W ASLDP ++++D DW Sbjct: 27 LNRDLLVAIFERMGVADLIAGVPFVCSSWRVASLDPLCWRNLDFRDW 73 >ref|XP_008793533.1| PREDICTED: F-box/LRR-repeat protein At3g48880-like isoform X2 [Phoenix dactylifera] Length = 187 Score = 52.8 bits (125), Expect = 8e-06 Identities = 20/44 (45%), Positives = 31/44 (70%) Frame = +1 Query: 70 LPKDLLLRIFSKLGIEEILVGAPLACRAWYAASLDPSLYKDIDI 201 LP D L+ IF +LG+E++ G P C++WY A L+PS +K +D+ Sbjct: 46 LPLDCLVNIFKRLGVEDMTTGVPFVCKSWYEAHLNPSCWKILDL 89