BLASTX nr result
ID: Ophiopogon22_contig00027585
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00027585 (580 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020104091.1| fasciclin-like arabinogalactan protein 21 [A... 62 1e-07 ref|XP_010939965.1| PREDICTED: fasciclin-like arabinogalactan pr... 59 8e-07 ref|XP_008787970.1| PREDICTED: fasciclin-like arabinogalactan pr... 56 9e-06 >ref|XP_020104091.1| fasciclin-like arabinogalactan protein 21 [Ananas comosus] Length = 429 Score = 61.6 bits (148), Expect = 1e-07 Identities = 40/86 (46%), Positives = 51/86 (59%), Gaps = 4/86 (4%) Frame = +2 Query: 254 LVATLDPFPFLDTAASSYPLH-YSLSSRIAVNPPQQAQPGTP---LASILSNLGFQELSM 421 LVA F +AAS+Y L ++ S PPQ A+ LA ILSNLGFQEL+M Sbjct: 8 LVALALLFSATSSAASAYALPPFNQSPSPPPPPPQSAEEAHEVLLLAPILSNLGFQELAM 67 Query: 422 GFPFVASILPSPWSSPVTMLAPSDDS 499 P ++S + S WS P+T+ APSDDS Sbjct: 68 AVPALSSPVLSTWSGPLTLFAPSDDS 93 >ref|XP_010939965.1| PREDICTED: fasciclin-like arabinogalactan protein 21 [Elaeis guineensis] Length = 390 Score = 58.9 bits (141), Expect = 8e-07 Identities = 30/60 (50%), Positives = 38/60 (63%) Frame = +2 Query: 320 SLSSRIAVNPPQQAQPGTPLASILSNLGFQELSMGFPFVASILPSPWSSPVTMLAPSDDS 499 S +S PPQ+ LA ILSNLGFQEL+M P + S + S WS P+T+ APSDD+ Sbjct: 22 STASGSPAPPPQEPHQAFLLAPILSNLGFQELAMAVPAIYSPVLSAWSGPLTLFAPSDDT 81 >ref|XP_008787970.1| PREDICTED: fasciclin-like arabinogalactan protein 21 [Phoenix dactylifera] Length = 394 Score = 55.8 bits (133), Expect = 9e-06 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = +2 Query: 347 PPQQAQPGTPLASILSNLGFQELSMGFPFVASILPSPWSSPVTMLAPSDDS 499 PPQ+ LA ILSNLGFQEL+M P + S + S WS P+T+ A SDDS Sbjct: 31 PPQEPHQAFLLAPILSNLGFQELAMAVPALYSPVLSAWSGPLTLFASSDDS 81