BLASTX nr result
ID: Ophiopogon22_contig00027220
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00027220 (790 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272105.1| uncharacterized protein LOC109847277 [Aspara... 60 1e-06 >ref|XP_020272105.1| uncharacterized protein LOC109847277 [Asparagus officinalis] gb|ONK79122.1| uncharacterized protein A4U43_C01F3160 [Asparagus officinalis] Length = 394 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 261 IEDLLAVTAVSIRGRQQTTNQQKKGTVASSKAMEDFDSWLDTL 133 I+DLLAVT+ S+ ++ NQQ KGT + SKAMEDFDSWLDTL Sbjct: 352 IDDLLAVTSASLEEQKPAANQQNKGTDSPSKAMEDFDSWLDTL 394