BLASTX nr result
ID: Ophiopogon22_contig00026986
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00026986 (640 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_080489929.1| hypothetical protein [Enterococcus faecium] 53 9e-06 >ref|WP_080489929.1| hypothetical protein [Enterococcus faecium] Length = 102 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = -1 Query: 640 MIRRPPRSTLFPYTTLFRSTILPARTLSSELWTALIEAIWYAGRMVAGIFRTE 482 MIRRPPRSTLFPYTTLFRS+ A T S+ +W L++ I G +F T+ Sbjct: 21 MIRRPPRSTLFPYTTLFRSSYAIAPTESTYVWNELLQDINSRGVQEVLLFITD 73