BLASTX nr result
ID: Ophiopogon22_contig00026960
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00026960 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252514.1| probable GTP-binding protein OBGM, mitochond... 62 2e-08 ref|XP_010926742.1| PREDICTED: probable GTP-binding protein OBGM... 55 5e-06 >ref|XP_020252514.1| probable GTP-binding protein OBGM, mitochondrial [Asparagus officinalis] ref|XP_020252515.1| probable GTP-binding protein OBGM, mitochondrial [Asparagus officinalis] gb|ONK76922.1| uncharacterized protein A4U43_C02F1280 [Asparagus officinalis] Length = 624 Score = 61.6 bits (148), Expect = 2e-08 Identities = 41/103 (39%), Positives = 53/103 (51%) Frame = -3 Query: 394 LVSGDAPSFVVDTSIKSLQPWEIPDTDQIGPLKSLQHSENHVSSVNSLDKEATGDSPSPQ 215 LVSG+APSFV + S+KSLQPWEIP+TD+ G +S Q S + V LDK Sbjct: 139 LVSGEAPSFVENISVKSLQPWEIPETDEAGKSRSFQPSNSSV-----LDKG--------- 184 Query: 214 PKCYVGKSDGLHHEVSEISGSTGGKGKTNFKYPSSHHELDAKM 86 Y S G H + E + K + K SH E D++M Sbjct: 185 ---YGRNSGGSHRKAFETP-----REKADLKRSHSHFESDSRM 219 >ref|XP_010926742.1| PREDICTED: probable GTP-binding protein OBGM, mitochondrial [Elaeis guineensis] Length = 529 Score = 54.7 bits (130), Expect = 5e-06 Identities = 28/58 (48%), Positives = 35/58 (60%) Frame = -3 Query: 394 LVSGDAPSFVVDTSIKSLQPWEIPDTDQIGPLKSLQHSENHVSSVNSLDKEATGDSPS 221 LVSG+ P FV SI SL PWEIP T + P KS+QH + V + L+K+ DS S Sbjct: 142 LVSGEIPCFVESISIASLNPWEIPGTLEGNPSKSVQHDDRRVIASGGLEKKNFDDSQS 199