BLASTX nr result
ID: Ophiopogon22_contig00026865
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00026865 (801 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275940.1| sucrose transport protein SUT4-like isoform ... 59 2e-06 gb|ONK64025.1| uncharacterized protein A4U43_C07F21330 [Asparagu... 59 2e-06 ref|XP_020275939.1| sucrose transport protein SUT4-like isoform ... 59 3e-06 ref|XP_020275938.1| sucrose transport protein SUT4-like isoform ... 59 3e-06 gb|ONK79720.1| uncharacterized protein A4U43_C01F9370 [Asparagus... 58 4e-06 >ref|XP_020275940.1| sucrose transport protein SUT4-like isoform X3 [Asparagus officinalis] Length = 471 Score = 59.3 bits (142), Expect = 2e-06 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 25/100 (25%) Frame = -2 Query: 227 PNLYDTTLMILKSFTSYIPYFRVTMN-------------------------RKGKFYRIL 123 P ++ L++ ++TS+ P+F + R+G F +L Sbjct: 240 PGMHSVLLVMALTWTSWFPFFLFDTDWMGREVYHGNPNGNTNEIFMYQNGVREGAFGLLL 299 Query: 122 MTNWHCVLGISSFLIASICLRMGSKVVWAFNNFIVFICMA 3 + VLGISSFLI +C +MGSK+VWA +NFIVFICMA Sbjct: 300 NS---VVLGISSFLIDPMCRKMGSKIVWAMSNFIVFICMA 336 >gb|ONK64025.1| uncharacterized protein A4U43_C07F21330 [Asparagus officinalis] Length = 492 Score = 59.3 bits (142), Expect = 2e-06 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 25/100 (25%) Frame = -2 Query: 227 PNLYDTTLMILKSFTSYIPYFRVTMN-------------------------RKGKFYRIL 123 P ++ L++ ++TS+ P+F + R+G F +L Sbjct: 261 PGMHSVLLVMALTWTSWFPFFLFDTDWMGREVYHGNPNGNTNEIFMYQNGVREGAFGLLL 320 Query: 122 MTNWHCVLGISSFLIASICLRMGSKVVWAFNNFIVFICMA 3 + VLGISSFLI +C +MGSK+VWA +NFIVFICMA Sbjct: 321 NS---VVLGISSFLIDPMCRKMGSKIVWAMSNFIVFICMA 357 >ref|XP_020275939.1| sucrose transport protein SUT4-like isoform X2 [Asparagus officinalis] Length = 597 Score = 59.3 bits (142), Expect = 3e-06 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 25/100 (25%) Frame = -2 Query: 227 PNLYDTTLMILKSFTSYIPYFRVTMN-------------------------RKGKFYRIL 123 P ++ L++ ++TS+ P+F + R+G F +L Sbjct: 366 PGMHSVLLVMALTWTSWFPFFLFDTDWMGREVYHGNPNGNTNEIFMYQNGVREGAFGLLL 425 Query: 122 MTNWHCVLGISSFLIASICLRMGSKVVWAFNNFIVFICMA 3 + VLGISSFLI +C +MGSK+VWA +NFIVFICMA Sbjct: 426 NS---VVLGISSFLIDPMCRKMGSKIVWAMSNFIVFICMA 462 >ref|XP_020275938.1| sucrose transport protein SUT4-like isoform X1 [Asparagus officinalis] Length = 624 Score = 59.3 bits (142), Expect = 3e-06 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 25/100 (25%) Frame = -2 Query: 227 PNLYDTTLMILKSFTSYIPYFRVTMN-------------------------RKGKFYRIL 123 P ++ L++ ++TS+ P+F + R+G F +L Sbjct: 366 PGMHSVLLVMALTWTSWFPFFLFDTDWMGREVYHGNPNGNTNEIFMYQNGVREGAFGLLL 425 Query: 122 MTNWHCVLGISSFLIASICLRMGSKVVWAFNNFIVFICMA 3 + VLGISSFLI +C +MGSK+VWA +NFIVFICMA Sbjct: 426 NS---VVLGISSFLIDPMCRKMGSKIVWAMSNFIVFICMA 462 >gb|ONK79720.1| uncharacterized protein A4U43_C01F9370 [Asparagus officinalis] Length = 340 Score = 58.2 bits (139), Expect = 4e-06 Identities = 36/100 (36%), Positives = 51/100 (51%), Gaps = 25/100 (25%) Frame = -2 Query: 227 PNLYDTTLMILKSFTSYIPYFRVTMN-------------------------RKGKFYRIL 123 P ++ L++ ++TS+ P+F + R+G F +L Sbjct: 109 PGMHSVLLVMALTWTSWFPFFLFDTDWMGREVYHGDPNGNSNQNDAYQNGVREGAFGLLL 168 Query: 122 MTNWHCVLGISSFLIASICLRMGSKVVWAFNNFIVFICMA 3 + VLGISSFLI +C +MGSK VWA +NFIVFICMA Sbjct: 169 NS---VVLGISSFLIDPMCRKMGSKTVWAMSNFIVFICMA 205